KEGG   Geobacter sp. M21: GM21_3863Help
Entry
GM21_3863         CDS       T00933                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
gem  Geobacter sp. M21
Pathway
gem00330  Arginine and proline metabolism
gem00332  Carbapenem biosynthesis
gem01100  Metabolic pathways
gem01130  Biosynthesis of antibiotics
gem01230  Biosynthesis of amino acids
Module
gem_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GM21_3863
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    GM21_3863
Enzymes [BR:gem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GM21_3863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACT19880
UniProt: C6E7M0
Position
complement(4448379..4449500)
Genome map
AA seq 373 aa AA seqDB search
MRKELLKKVKRVVVKIGSGVLTGENGGVDPGFLDGLAAQVAELSGQGTEVVIVSSGAVAA
GRQALGLPDRPRTLPQKQAAAAVGQSRLMRAYEEAFSSYDLKVAQILLTRDDLANRRRFQ
NARGTLDTLLACGIIPVINENDTVVVDELKFGDNDNLSALVTNLVEAQLLLIMTDIDGLY
TADPRTDPNATLIHQVGAVTRELERGAGGSGTSVGTGGMATKLAAAKKVVKSGVAAIIFA
GRGERTLSRVMKGELLGTLFLPAGESLNRRKHWIAFTIKPAGSIVVDAGARDVLARHGRS
LLPSGIAQVEGRFDRGACVRVLDPDGVEFARGITDYSSQEVEKIRGHQSSEIERILGFRY
GDDVIHRDNLVLL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaggaactgcttaaaaaggtaaaacgggtcgtggtgaagatcggatccggcgtc
ctgaccggcgaaaacggcggggtcgaccccggtttcctggacgggctcgcggcgcaggtc
gcggagttgagcgggcaggggaccgaggtggtgatcgtctcctccggggccgtggcggca
gggcgccaggcgctggggctcccggaccgcccgaggaccctcccccagaagcaggccgcg
gccgcggtggggcagtcccggctgatgcgggcctacgaggaggccttctcctcctacgac
ctcaaggtggcccagatacttctgacgcgcgacgacctggccaacaggcgccgcttccag
aacgcccgcgggaccctggacacccttttggcctgcggcatcatcccggtcatcaacgaa
aacgacacggtcgtggtcgacgagctcaagttcggcgacaacgacaacctctcggcgctg
gtgaccaacctggtcgaggcgcaactccttttgatcatgaccgacatcgacggcctctac
accgccgacccgcgcaccgaccccaacgccaccctgatccaccaggtgggagcggtgacc
cgggagcttgagcgcggcgccggcggcagcggcaccagcgtcggcaccggcggcatggcc
acaaagctcgccgcggccaagaaggtggtcaagtccggcgtggcggccatcatcttcgcc
gggcggggggagcgcaccctctcgcgcgtcatgaagggggagctcctcggcaccctgttc
ctgccggccggcgagtcgctgaaccggcgcaagcactggatcgccttcaccatcaagccc
gcaggctccatcgtcgtcgatgccggggcgcgcgacgtcctcgcccggcacggcaggagc
ctccttccttccggcatcgcccaggtcgaggggcgcttcgaccgcggcgcctgcgtccgg
gtgttagaccccgatggggtcgagttcgcgcgcggcatcaccgattattcgagccaggag
gtggagaagatccgcgggcatcaaagcagcgagatcgagcggatcctgggctttcgctac
ggcgacgacgtcatccaccgggataacctggtccttttgtaa

DBGET integrated database retrieval system