KEGG   Geobacter sp. M21: GM21_3894Help
Entry
GM21_3894         CDS       T00933                                 

Definition
(GenBank) cobyrinic acid a,c-diamide synthase
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
gem  Geobacter sp. M21
Pathway
gem00860  Porphyrin and chlorophyll metabolism
gem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GM21_3894
Enzymes [BR:gem01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     GM21_3894
    6.3.5.11  cobyrinate a,c-diamide synthase
     GM21_3894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB MipZ
Motif
Other DBs
NCBI-ProteinID: ACT19911
UniProt: C6E7Q1
Position
complement(4480909..4482291)
Genome map
AA seq 460 aa AA seqDB search
MKRIVIAAPSSGCGKTTVTLGVMAALKRRGLKVAPFKVGPDFIDPGYHRVATGVPSVNLD
GWICDPHFLRESFLHHAAAADIAVVEGAMGLFDGIDGLSESGSSAQVAKELAAPVVLVVD
ARSQARSAAALVHGFAGFDPALRVAGVIFNNVASENHERILREALGAAVPGVQVIGCLPR
DPALAIPSRHLGLVTVEDNPLSDPFLDHLVAVVEEHLYLDALLDLEVDELRDHAAPAAGS
PAASRDRVRIAVARDAAFCFVYEDNLRLLEQSGAELCYFSPLADSLLPEAIGGIYLPGGY
PELFAARLAANEPMKQEIRQAVEGGMPVYAECGGFIYLTRGVAAEGESHGFAGIFPVETR
MLPRRKALGYREVELLEDCTLGRKGSIARGHEFHYSEMQEMPPNVERLYRVTRKGVELAP
EGYRYKNCLASYIHLHFGSSPGLAPHFVEQGRAYQKRSLT
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggatcgtgatagcggcgccctccagcggctgcgggaagaccaccgtgaccttg
ggcgtcatggcggccctgaaaaggcgcggcctcaaggtggcccccttcaaggtgggaccg
gacttcatcgatcccggctatcaccgggtggcgaccggggtcccctccgtcaacctggac
ggctggatctgcgatccccatttcctgagggagagcttcctccaccatgcggccgctgcg
gacatcgcggtcgtcgagggggcgatggggctctttgacgggatcgacgggctctccgaa
tcggggagcagcgcgcaggtcgccaaggaactcgcagcccccgtggtcctcgtggtggat
gcgcgcagccaggcgagaagcgccgcagcgctggtgcacggcttcgccggcttcgacccg
gcgctgcgggtggcaggggtcatcttcaacaacgtcgccagcgagaaccacgagcgcatc
ctgcgggaggcgctcggcgcggcggtgccgggcgtgcaggtgatcggctgcctccccagg
gaccccgccctcgccatcccttcgcgccatctgggactggtgacggtggaggacaacccg
ctctcggaccccttcctggaccacctggtcgctgtcgtggaagagcacctttacctcgac
gcgctcctcgacctggaggtcgacgaactgcgggatcatgccgcgccggccgccggcagc
cctgctgccagccgggaccgggtgaggatcgcggtggcgcgggacgcggccttctgcttc
gtctacgaggacaacctgcggctcctggagcaaagcggggccgaactctgctacttctcc
cccctcgccgacagcttgttgccggaggctatcggcggcatctacctccccggggggtac
cctgagctcttcgcggcgcgccttgccgccaacgagccgatgaaacaggagatccggcag
gcggtggaggggggaatgcccgtctatgccgagtgcggcgggttcatctacctcacccgt
ggggtggccgcggagggggaaagccatggctttgccggcatcttcccggtagagacccgg
atgctgccgcgccgcaaggcgctcgggtaccgcgaggtggaactgctggaagattgcacg
ctcggccgcaaggggagcatcgcccgcggccacgagttccactactccgagatgcaggaa
atgccccccaacgtggagcgcctgtaccgggtcacccgcaagggggtggaactcgcgccc
gaaggttaccgttacaaaaactgcctcgcctcttacatacatctacacttcggcagctcg
ccaggcctggctcctcacttcgtggaacagggaagggcgtaccaaaaaaggagcctcaca
tga

DBGET integrated database retrieval system