KEGG   Geminocystis sp. NIES-3709: GM3709_740Help
Entry
GM3709_740        CDS       T04142                                 

Definition
(GenBank) light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein ChlL
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
gen  Geminocystis sp. NIES-3709
Pathway
gen00860  Porphyrin and chlorophyll metabolism
gen01100  Metabolic pathways
gen01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gen00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GM3709_740
Enzymes [BR:gen01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     GM3709_740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MipZ MeaB AAA_24 AAA_25 RNA_helicase NACHT SRP54 AAA_16
Motif
Other DBs
NCBI-ProteinID: BAQ63975
UniProt: A0A0D6AMS0
Position
818619..819491
Genome map
AA seq 290 aa AA seqDB search
MTLTLAVYGKGGIGKSTTSCNISTALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTL
QEKDFHYEDIWAEDVIYKGYAGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDV
ILFDVLGDVVCGGFAAPLNYADYCLIITDNGFDALFAANRIAASVREKARTHPLKLAGLI
GNRTSKRDLIDKYVSHVAMPVLEILPLIEDIRVSRVKGKTLFEMAEKDPSLDYVCQYYLN
IADQILALPEGVVPSEALDRELFGLLSDYYLNPPADAPKQEKDELELMMV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgactttgacattagcagtttacggaaaaggcggtatcggcaaatcaaccaccagttgc
aatatttctacagctttggctaaacggggtaaaaaagtattacaaattggatgtgatcca
aaacatgatagcactttcactctcacgggttttttaattcccacgatcatcgacactcta
caagaaaaagattttcactatgaagatatttgggcagaagacgttatttataaaggttac
gcaggtgttgattgtgtagaggcaggtggccctcctgctggtgctggttgtggtggttat
gtggtaggagaaaccgtaaaactgttaaaagagttaaacgcttttgatgaatatgacgtg
attttatttgacgtattgggtgacgtggtatgcggaggatttgccgcacctctcaactat
gctgactattgtttaattatcactgacaacggttttgatgcgttattcgctgccaatcgt
attgcggcatccgtcagagaaaaagcgcgtacccatcccctcaagttagctggtttaatc
ggtaatcgcacctctaaacgagatttgattgataaatatgtttcccatgtggcaatgcct
gtattagaaattttacctctgattgaggacatccgagtatcgagagttaagggtaaaacc
ttgtttgaaatggcggaaaaagatcctagtttagattatgtttgtcaatattaccttaac
attgctgatcagattttagctttacctgaaggagttgtgcctagtgaagcactcgatcga
gagttatttggattactttcagattactacttaaatcctcctgcggatgcgcctaaacaa
gaaaaagacgaattagagttaatgatggtataa

DBGET integrated database retrieval system