KEGG   Geminocystis sp. NIES-3709: GM3709_89Help
Entry
GM3709_89         CDS       T04142                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein MoaB
  KO
K03638  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
gen  Geminocystis sp. NIES-3709
Pathway
gen00790  Folate biosynthesis
gen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gen00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GM3709_89
Enzymes [BR:gen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     GM3709_89
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: BAQ63324
UniProt: A0A0D6ALI0
Position
complement(128098..128601)
Genome map
AA seq 167 aa AA seqDB search
MTIPHQNFNIKSVNCAVITVSDTRTFDTDISGKIIQEMLINASHKIIHYEIIKDEPQDLK
CLLVNLASKEQLNCIIFSGGTGISLRDNTYDIVSQMLEKTLSGFGEIFRYLSYQEIGSRS
IASRATAGLYNGKIVFSLPGSENAVRLGLEKLIIPELIHLVDQISKG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgactattcctcatcaaaattttaatataaaaagtgtcaattgtgctgttattaccgtt
agtgatactaggacttttgatactgatattagcggtaaaattattcaagaaatgttaatt
aatgctagtcataaaattattcattatgaaattatcaaagatgaacctcaagatctaaaa
tgtttgttagtaaatttagcatctaaagaacaattaaactgcattattttttctggaggt
acgggtatatcgttaagggataatacttatgatatagttagtcaaatgttagaaaaaact
ttatcaggttttggggagatatttcgctatttaagttatcaggaaataggttctcgatcg
atagcatcaagagcaacagcagggttatataatggtaaaatagtattttctttacccggc
tctgaaaatgctgttagactaggtttagaaaagctcattatacccgaattaattcattta
gttgatcagataagtaaaggttag

DBGET integrated database retrieval system