GenomeNet

Database: GenBank
Entry: AB306314
LinkDB: AB306314
LOCUS       AB306314                2753 bp    DNA     circular VRL 26-AUG-2010
DEFINITION  Ageratum yellow vein virus-Ishigaki DNA, complete genome.
ACCESSION   AB306314
VERSION     AB306314.1
KEYWORDS    .
SOURCE      Ageratum yellow vein virus-Ishigaki
  ORGANISM  Ageratum yellow vein virus-Ishigaki
            Viruses; ssDNA viruses; Geminiviridae; Begomovirus.
REFERENCE   1
  AUTHORS   Andou,T., Yamaguchi,A., Kawano,S., Kawabe,K., Ueda,S. and Onuki,M.
  TITLE     Ageratumyellow vein virus isolated from tomato plants with leaf
            curl on Ishigaki Island, Okinawa, Japan
  JOURNAL   J. Gen. Plant Pathol. 76, 287-291 (2010)
REFERENCE   2  (bases 1 to 2753)
  AUTHORS   Onuki,M., Andou,T., Yamaguchi,A., Kawano,S., Kawabe,K. and Ueda,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAY-2007) Contact:Masatoshi Onuki National
            Agricultural Research Center for Kyushu Okinawa Region; Suya 1192,
            Koshi, Kumamoto 861-1192, Japan
FEATURES             Location/Qualifiers
     source          1..2753
                     /organism="Ageratum yellow vein virus-Ishigaki"
                     /mol_type="genomic DNA"
                     /isolate="Tomato-Ishigaki05"
                     /db_xref="taxon:446318"
                     /country="Japan: Okinawa, Ishigaki Island"
                     /collection_date="Apr-2005"
                     /collected_by="Masatoshi Onuki"
                     /identified_by="Masatoshi Onuki"
     gene            133..483
                     /gene="V2"
     CDS             133..483
                     /gene="V2"
                     /codon_start=1
                     /product="V2 protein"
                     /protein_id="BAF80879.1"
                     /translation="MWDPLLNEFPETVHGFRCMLAVKYLQLVEQTYSPDTIGHDLIRD
                     LISVIRARNYVEASRRYCHFHSRLEGTSPSELRHPRDEPCCCPHCPRHQQKKDMDQQA
                     HVPQAQTVQNVQNP"
     gene            293..1066
                     /gene="V1"
     CDS             293..1066
                     /gene="V1"
                     /codon_start=1
                     /product="coat protein"
                     /protein_id="BAF80880.1"
                     /translation="MSKRPADIVISTPASKVRRRLNFDTPVMSRAAAPTVLVTNRRRT
                     WTNRPMYRKPRLYRMYRTPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSDVTRGNGL
                     THRVGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPFGTAMDFGQVFNMY
                     DNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYASKEQALVKKFMKINNYVVYNHQEAA
                     KYDNHTENALLLYMACTHASNPVYATLKIRIYFYDSVQN"
     gene            complement(1063..1467)
                     /gene="C3"
     CDS             complement(1063..1467)
                     /gene="C3"
                     /codon_start=1
                     /product="C3 protein"
                     /protein_id="BAF80881.1"
                     /translation="MDFRTGELLTATQCESGVYTWTIKNPLYFKIIKHHERPFNTNHD
                     IITIRIQFNHNLRKALGIHQCFLIFQIWTRLQPQTWRFLRVFRVQCMKYLNNLGVISI
                     NNVIRACDHVLWDVLENTEYVTNSHIIKFNLY"
     gene            complement(1208..1615)
                     /gene="C2"
     CDS             complement(1208..1615)
                     /gene="C2"
                     /codon_start=1
                     /product="C2 protein"
                     /protein_id="BAF80882.1"
                     /translation="MRNSSPSTGHCTQVPIKVQHRIAKRRPVRRRRVDLTCGCSYYFG
                     IDCANHGFSHRGITHCNSMREWRIYLDNQKSPIFQDNQAPREAIQHQPRHHNDQNTVQ
                     SQPEESVGNTPVFSDLPDLDSLTTSDLAFLKSI"
     gene            complement(1521..2603)
                     /gene="C1"
     CDS             complement(1521..2603)
                     /gene="C1"
                     /codon_start=1
                     /product="replication-associated protein"
                     /protein_id="BAF80883.1"
                     /translation="MAPPRPFKINAKNYFLTYPQCSLTKEETLSQIQALDTPTNKKYI
                     KICRELHEDGSPHLHVLIQFEGKYQCKNNRFFDLISPSRSAHFHPNIQGAKSSSDVKS
                     YIDKDGDTLEWGEFQIDGRSARGGQQTANDAYAQALNSGSKSEALNVIKELAPKDYVL
                     QFHNLNANLDRIFAPPLEVFVCPFLSSSFDQVPEELEEWVSENVSGAAARPWRPISIV
                     IEGDSRTGKTMWARSLGPHNYLCGHLDLSPKVYSNDAWYNVIDDVDPHYLKHFKEFMG
                     AQRDWQSNTKYGKPIQIKGGIPTIFLCNPGPTSSYKEYLDEEKNSALKEWAIKNAEFI
                     TLNRPLYSGTNQSAAQNSEEEASSQA"
     gene            complement(2156..2446)
                     /gene="C4"
     CDS             complement(2156..2446)
                     /gene="C4"
                     /codon_start=1
                     /product="C4 protein"
                     /protein_id="BAF80884.1"
                     /translation="MGALISTCLSSSKGNTSARITDSSTLYPLPGQHISIRTFRELNP
                     APTSSPISTRTETPSNGVSFRSMDDLQEEDNRQPMTLTPRHLTAAVSQRLLM"
ORIGIN      
        1 accggatggc cgcgattttt ttttaaagtg gtccctacca cgaacaaaaa tcccccactc
       61 agaacgctcc ctcaaagtta aattattaag tggtccccta tttatactta ttctccaagt
      121 attattttaa acatgtggga tcctcttttg aacgagtttc ctgaaactgt tcacggtttt
      181 aggtgtatgc ttgccgtaaa atatcttcaa ttagttgaac agacatactc tcctgatacg
      241 attggtcacg atcttatacg cgatttaatt tcagtaattc gtgctcgcaa ttatgtcgaa
      301 gcgtcccgca gatattgtca tttccactcc cgcctcgaag gtacgtcgcc gtctgaactt
      361 cgacaccccc gtgatgagcc gtgctgctgc ccccactgtc ctcgtcacca acagaagaag
      421 gacatggacc aacaggccca tgtaccgcaa gcccagactg tacagaatgt acagaacccc
      481 tgatgtgccc aaaggttgtg aaggcccatg taaggtccaa tcctatgaac agaggcacga
      541 catatcccat gtaggtaaag tattatgtgt tagtgatgtc acccgtggta atgggcttac
      601 ccatcgtgtt ggtaagagat tctgtgttaa gtccgtttat gtattgggta aaatatggat
      661 ggatgaaaat atcaaaacta agaaccatac gaacactgtg atgttttatc ttgttcgtga
      721 cagaaggccc tttggtactg ctatggattt cggtcaggtg tttaacatgt atgataatga
      781 gcctagtact gctactatca agaatgatct tcgagaccgt tatcaagttc taaggaaatt
      841 cacttcaaca gtcacaggtg gtcaatatgc ttctaaggaa caggcgttgg tcaagaaatt
      901 tatgaagatt aataattatg tagtttataa tcatcaagaa gctgctaagt atgacaatca
      961 tactgagaat gccttgttat tgtatatggc ttgtactcat gccagtaatc cagtgtatgc
     1021 tactttgaag atcagaatct atttctatga ttctgttcag aattaataaa gattgaattt
     1081 tattatatga gaatttgtta catattctgt attttccaat acatcccata atacatgatc
     1141 acatgctcta attacattgt taatactaat tacacccaaa ttatttaaat atttcataca
     1201 ttgaacccta aatactctta agaaacgcca agtctgaggt tgtaagcgag tccagatctg
     1261 gaagatcaga aaacactggt gtattcccaa cgctttcctc aggttgtgat tgaactgtat
     1321 tctgatcgtt atgatgtcgt ggttggtgtt gaatggcctc tcgtggtgct tgattatctt
     1381 gaaatatagg ggatttttga ttgtccaggt atatacgcca ctctcgcatt gagttgcagt
     1441 gagtaattcc cctgtgcgaa aatccatgat ttgcacaatc tatgccgaag tagtatgaac
     1501 acccgcacgt tagatcaact ctacgcctgc gaactggcct cctcttcgct attctgtgct
     1561 gcactttgat tggtacctga gtacaatggc ctgttgaggg tgatgaattc cgcattcttt
     1621 atagcccact cttttaatgc tgaattcttt tcttcgtcca agtactcttt atatgatgat
     1681 gttgggcctg gattgcaaag gaagatagtt gggattccac ctttaatttg aattggtttc
     1741 ccgtatttag tgttgctttg ccagtccctt tgggccccca tgaattcttt aaagtgcttt
     1801 agatagtggg ggtctacgtc atcaatgacg ttataccaag catcattact gtataccttt
     1861 ggactcagat ctagatgacc gcacagataa ttatgtggtc ccagtgatct ggcccacatt
     1921 gttttaccag tacgactatc accttctatc acaatactga tgggtctcca tggccgcgca
     1981 gcggcaccac tcacattttc agaaacccac tcttcaagtt cttctggaac ttgatcaaat
     2041 gaagaagata aaaaaggaca aacaaaaacc tctaaaggag gtgcaaaaat cctatctaaa
     2101 ttagcattta aattatgaaa ttgtaaaaca taatctttag gagctaactc cttaattaca
     2161 ttaagagcct ctgacttact gccgctgtta agtgcctggg cgtaagcgtc attggctgtc
     2221 tgttgtcctc ctcttgcaga tcgtccatcg atctgaaact caccccattc gagggtgtct
     2281 ccgtccttgt cgatatagga cttgacgtcg gagctggatt tagctccctg aatgttcgga
     2341 tggaaatgtg ctgacctgga aggggatata aggtcgaaga atctgttatt cttgcactgg
     2401 tatttccctt cgaactggat aagcacgtgg agatgagggc tcccatcttc gtgcaattct
     2461 ctgcagattt ttatgtattt tttattagtt ggtgtatcta gggcttgaat ttgggaaagt
     2521 gtttcttctt tagtaagaga gcactgtgga taagtgagga aataattttt ggcatttatt
     2581 ttaaatggtc ttggaggagc cattgacttg gtcaatcggt gtctctacta atgctctagc
     2641 aatcggtgta ctggagtcct atatatagtt agacaccaaa tggcaattat gtaattttga
     2701 aaagaaattc atactttaat ttgaaatcca aaagcggcca tccgtataat att
//
DBGET integrated database retrieval system