LOCUS AF109399 1768 bp DNA circular VRL 23-JUL-2001
DEFINITION Porcine circovirus type 2-E, complete genome.
ACCESSION AF109399
VERSION AF109399.1
KEYWORDS .
SOURCE Porcine circovirus type 2-E
ORGANISM Porcine circovirus type 2-E
Viruses; Monodnaviria; Shotokuvirae; Cressdnaviricota;
Arfiviricetes; Cirlivirales; Circoviridae; Circovirus; Circovirus
porcine2.
REFERENCE 1 (bases 1 to 1768)
AUTHORS Hamel,A.L., Lin,L.L., Sachvie,C., Grudeski,E. and Nayar,G.P.
TITLE PCR detection and characterization of type-2 porcine circovirus
JOURNAL Can. J. Vet. Res. 64 (1), 44-52 (2000)
PUBMED 10680656
REFERENCE 2 (bases 1 to 1768)
AUTHORS Hamel,A.L. and Nayar,G.P.S.
TITLE Nucleotide sequence of four different isolates of circovirus
detected in pigs with various clinical syndromes
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 1768)
AUTHORS Hamel,A.L. and Nayar,G.P.S.
TITLE Direct Submission
JOURNAL Submitted (27-NOV-1998) Virology Laboratory, Veterinary Diagnostic
Laboratory, Manitoba Agriculture, 545 University Crescent,
Winnipeg, Manitoba R3T 5S6, Canada
FEATURES Location/Qualifiers
source 1..1768
/organism="Porcine circovirus type 2-E"
/mol_type="genomic DNA"
/db_xref="taxon:85544"
/note="similar to Porcine circovirus sequence presented in
GenBank Accession Number AF027217; type-E designation is
based upon restriction endonuclease digestion pattern;
sequence obtained from several overlapping PCRs using DNA
extracted from lung, mesenteric lymph node and tonsil of
pig"
stem_loop join(1750..1768,1..13)
rep_origin join(1762..1768,1..2)
/note="putative; similar to the nonanucleotide motif of
Porcine circovirus presented in GenBank Accession Numbers
AF027217 and U49186"
repeat_region 13..35
/rpt_type=tandem
/rpt_unit_range=13..18
CDS 51..995
/note="ORF-1"
/codon_start=1
/product="putative Rep and coat protein"
/protein_id="AAD03071.1"
/translation="MPSKKNGRSGPQPHKRWVFTLNNPSEDERKKIRELPISLFDYFI
VGEEGNEEGRTPHLQGFANFVKKQTFNKVKWYLGARCHIEKAKGTDQQNKEYCSKEGN
LLIECGAPRSQGQRSDLSTAVSTLLESGSLVTVAEQHPVTFVRNFRGLAELLKVSGKM
QKRDWKTNVHVIVGPPGCGKSKWAANFADPETTYWKPPRNKWWDGYHGEEVVVIDDFY
GWLPWDDLLRLCDRYPLTVETKGGTVPFLARSILITSNQTPLEWYPSTAVPAVEALYR
RITSLVFWKNATEQSTEEGGQFVTLSPPCPEFPYEINY"
regulatory 327..332
/regulatory_class="polyA_signal_sequence"
CDS complement(357..671)
/codon_start=1
/product="ORF-3"
/protein_id="AAD03073.1"
/translation="MVTIPPLVSRWFPVCGFRVCKISSPFAFTTPRWPHNDVYIGLPI
TLLHFPAHFQKFSQPAEISDKRYRVLLCNGHQTPALQQGTHSSRQVTPLSLRSRSSTL
NK"
CDS complement(386..565)
/codon_start=1
/product="ORF-4"
/protein_id="AAD03074.1"
/translation="MTCTLVFQSRFCIFPLTFKSSASPRKFLTNVTGCCSATVTRLPL
SNKVLTAVDRSLRCP"
CDS 553..732
/codon_start=1
/product="ORF-12"
/protein_id="AAD03081.1"
/translation="MYTSLWGHLGVVKANGLLILQTRKPHTGNHLETSGGMVTMVKKW
LLLMTFMAGCRGMIY"
CDS complement(688..753)
/codon_start=1
/product="ORF-8"
/protein_id="AAD03078.1"
/translation="MDIDHTVSVDHPTAASHKSHQ"
regulatory 983..988
/regulatory_class="polyA_signal_sequence"
CDS complement(989..1033)
/codon_start=1
/product="ORF-11"
/protein_id="AAD03080.1"
/translation="MNNKNHYEVIKKTQ"
CDS 1016..1363
/note="similar to Porcine circovirus ORF-5 encoded by the
sequence presented in GenBank Accession Number AF027217"
/codon_start=1
/product="ORF-5"
/protein_id="AAD03075.1"
/translation="MVFIIHLGFKWGVFKIKFSELYIHGYTDIVVLVVFTVFERSAEA
YVVHISTGLESHPQLIPFVIWLEVINSGIKNRFGCEVPGVVGEGLGDCMAGGVVYVGV
IGLGCGLYYKVVI"
regulatory complement(1022..1027)
/regulatory_class="polyA_signal_sequence"
CDS complement(1034..1735)
/codon_start=1
/product="ORF-2"
/protein_id="AAD03072.1"
/translation="MTYPRRRFRRRRHRPRSHLGQILRRRPWLVHPRHRYRWKRKNGI
FNARLSRTFGYTVKATTVSTPSWAVDMLRFNLDDFVPPGGGTNKISIPFEYYRIRKVK
VEFWPCSPITQGDRGVGSSAIILDDNFVIKATAQTYDPYVNYSSRHTIPQPFSYHSRY
FTPKPVLDSTIDYFQPNNKRNQLWMRLQTSRNVDHVGLGTAFENSKYDQDYNIRVTMY
VQFREFNLKDPPLKP"
CDS 1524..1631
/codon_start=1
/product="ORF-10"
/protein_id="AAD03079.1"
/translation="MSTAQEGVLTVVALTVYPKVRERRALKMPFFLFQR"
CDS complement(1528..1611)
/codon_start=1
/product="ORF-6"
/protein_id="AAD03076.1"
/translation="MASSTPASPAPSDILSRLPQSARPPGR"
CDS 1682..1741
/codon_start=1
/product="ORF-7"
/protein_id="AAD03077.1"
/translation="MAAGAVSSSAETPPWIRHS"
ORIGIN
1 accagcgcac ttcggcagcg gcagcacctc ggcagcacct cagcagcaac atgcccagca
61 agaagaatgg aagaagcgga ccccaaccac ataaaaggtg ggtgttcacg ctgaataatc
121 cttccgaaga cgagcgcaag aaaatacggg agcttccaat ctccctgttt gattatttta
181 ttgttggcga ggagggtaat gaggaaggac gaacacctca cctccagggg ttcgctaatt
241 ttgtgaaaaa gcaaactttt aataaagtga agtggtatct tggtgcccgc tgccacatcg
301 agaaagccaa aggaactgat cagcagaata aagaatattg cagtaaagaa ggcaacttac
361 ttattgagtg tggagctcct cgatctcaag gacaacggag tgacctgtct actgctgtga
421 gtaccttgtt ggagagcggg agtctggtga ccgttgcaga gcagcaccct gtaacgtttg
481 tcagaaattt ccgcgggctg gctgaacttt tgaaagtgag cgggaaaatg cagaagcgtg
541 attggaagac caatgtacac gtcattgtgg ggccacctgg gtgtggtaaa agcaaatggg
601 ctgctaattt tgcagacccg gaaaccacat actggaaacc acctagaaac aagtggtggg
661 atggttacca tggtgaagaa gtggttgtta ttgatgactt ttatggctgg ctgccgtggg
721 atgatctact gagactgtgt gatcgatatc cattgactgt agagactaaa ggtggaactg
781 tacctttttt ggcccgcagt attctgatta ccagcaatca gaccccgttg gaatggtacc
841 cctcaactgc tgtcccagct gtagaagctc tctatcggag gattacttcc ttggtatttt
901 ggaagaatgc tacagaacaa tccacggagg aagggggcca gttcgtcacc ctttcccccc
961 catgccctga atttccatat gaaataaatt actgagtctt ttttatcact tcgtaatggt
1021 ttttattatt catttagggt ttaagtgggg ggtctttaag attaaattct ctgaattgta
1081 catacatggt tacacggata ttgtagtcct ggtcgtattt actgttttcg aacgcagtgc
1141 cgaggcctac gtggtccaca tttctactgg tttggagtct catccacagc tgattccttt
1201 tgttatttgg ttggaagtaa tcaatagtgg aatcaagaac aggtttgggt gtgaagtacc
1261 tggagtggta ggagaagggt tgggggattg tatggcggga ggagtagttt acgtaggggt
1321 cataggtttg ggctgtggcc tttattacaa agttgtcatc tagaataata gcactggatc
1381 caactcccct gtcaccctgg gtgatcgggg agcagggcca gaattcaacc ttaacctttc
1441 ttattctgta gtattcaaag ggtatagaga ttttgttggt cccccctcct gggggaacaa
1501 agtcgtcaag attaaatctc agcatgtcta ccgcccagga gggcgtgctg actgtggtag
1561 ccttgacagt atatccgaag gtgcgggaga ggcgggcgtt gaagatgcca tttttccttt
1621 tccagcggta acggtggcgg gggtggacga gccaggggcg gcggcggagg atctggccaa
1681 gatggctgcg ggggcggtgt cttcgtctgc ggaaacgcct ccttggatac gtcatagctg
1741 aaaacgaaag aagtgcgctg taagtatt
//
