KEGG   Geobacter daltonii FRC-32: Geob_0243Help
Entry
Geob_0243         CDS       T00846                                 

Gene name
bamN
Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00071  Fatty acid degradation
geo00280  Valine, leucine and isoleucine degradation
geo00310  Lysine degradation
geo00362  Benzoate degradation
geo00380  Tryptophan metabolism
geo00620  Pyruvate metabolism
geo00630  Glyoxylate and dicarboxylate metabolism
geo00640  Propanoate metabolism
geo00650  Butanoate metabolism
geo00900  Terpenoid backbone biosynthesis
geo01100  Metabolic pathways
geo01110  Biosynthesis of secondary metabolites
geo01120  Microbial metabolism in diverse environments
geo01130  Biosynthesis of antibiotics
geo01200  Carbon metabolism
geo01212  Fatty acid metabolism
geo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:geo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Geob_0243 (bamN)
   00630 Glyoxylate and dicarboxylate metabolism
    Geob_0243 (bamN)
   00640 Propanoate metabolism
    Geob_0243 (bamN)
   00650 Butanoate metabolism
    Geob_0243 (bamN)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Geob_0243 (bamN)
   00072 Synthesis and degradation of ketone bodies
    Geob_0243 (bamN)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Geob_0243 (bamN)
   00310 Lysine degradation
    Geob_0243 (bamN)
   00380 Tryptophan metabolism
    Geob_0243 (bamN)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Geob_0243 (bamN)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Geob_0243 (bamN)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Geob_0243 (bamN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:geo04147]
    Geob_0243 (bamN)
Enzymes [BR:geo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Geob_0243 (bamN)
Exosome [BR:geo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Geob_0243 (bamN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACM18615
UniProt: B9M957
Position
299835..301010
Genome map
AA seq 391 aa AA seqDB search
MSEVFIVESLRTPLGSFGGALADVDAPRLAAAVIKELLERAALSPEAVDEVIIGQVLSGG
SGQAPARQALRYGGLPDSVPAMTINKVCGSGLKAIMLGADAIRLGDAHVVLAGGMENMSQ
APYALPKARNGFRMGNGEVVDLMVNDGLLDPYSGNHMGVIAEANAAKNGLSRAEQDEFAV
ASYKKAQAAVKDGVFKDEIVPVVKKGRQGEVVIAEDEEPLKGDIGKLPGLRAAFAKEGTI
TAGNASTINDGAGIALLASGEAVKKYNLKPKARLLAYATNSIHPDLFTEAPVGAIEKALV
KAGLKVGDIDLFELNEAFATVPLLAIKKLGIDPARVNVNGGAVAIGHPLGASGARLAATL
IRELHKRNARYGLATLCIGGGEAVAAIFERV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtttttatcgttgagtcattgcgtacgccgctgggatcgtttggtggtgcg
cttgccgacgtggatgcgccgcgtctggctgctgcagtcatcaaggagctgctggagaga
gcggctctcagtcccgaagctgtggatgaggtgattatcggtcaggtgctttccggggga
agcggtcaggctcccgccaggcaggctctgcgttatggcggcctccccgactcggtaccg
gcaatgaccatcaacaaggtgtgcggcagcggcctgaaagcgattatgctcggggccgat
gcaatacgtctgggagacgcccacgttgtgctggccggcggcatggagaacatgtcccag
gcaccctatgccctgcccaaggcgaggaatggtttccgtatggggaacggtgaagtggtt
gacctgatggtcaatgacggcctgttggatccatacagcggcaaccatatgggggtcatt
gccgaggccaatgctgccaaaaacggcctgagccgtgccgagcaggatgaatttgccgtc
gcttcctataaaaaagctcaagcagcggttaaagatggcgtgttcaaagatgagatagtg
ccagtggtgaaaaaggggcgccagggggaggtggtgattgccgaggatgaagagccgctc
aagggtgatatcggcaagctgcccgggctgcgtgccgcatttgccaaagagggaaccatc
accgctggtaacgcatccaccatcaacgacggcgccgggatagccctgctggcatccggc
gaagcggttaagaaatacaacctgaagccgaaggcccgtttgctagcctatgccaccaac
agtattcatcccgacctctttaccgaggcgccggtgggagccattgaaaaagcattggtc
aaggcagggctcaaggtgggtgacatcgatctcttcgagctcaatgaggcctttgccacc
gtgccgcttttggctatcaagaagctgggcatcgatcctgcccgggtcaacgtcaacggt
ggagcggtcgccatcggccaccccctcggagcgagcggcgcacgcctggcagctaccctt
ataagggaactgcacaagaggaatgcccgttatggccttgccaccctttgcattggcgga
ggagaagcggtcgcagcgatttttgagcgggtatag

DBGET integrated database retrieval system