KEGG   Geobacter daltonii FRC-32: Geob_0247Help
Entry
Geob_0247         CDS       T00846                                 

Gene name
sucC-2
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00020  Citrate cycle (TCA cycle)
geo00640  Propanoate metabolism
geo00660  C5-Branched dibasic acid metabolism
geo01100  Metabolic pathways
geo01110  Biosynthesis of secondary metabolites
geo01120  Microbial metabolism in diverse environments
geo01130  Biosynthesis of antibiotics
geo01200  Carbon metabolism
Module
geo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
geo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Geob_0247 (sucC-2)
   00640 Propanoate metabolism
    Geob_0247 (sucC-2)
   00660 C5-Branched dibasic acid metabolism
    Geob_0247 (sucC-2)
Enzymes [BR:geo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Geob_0247 (sucC-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ACM18619
UniProt: B9M961
Position
305151..306317
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQAKAILREFGVPVPDGHVCYNGASAREWAKRLSEGPWVVKAQIHAGGRGKGGGV
KLARTADEVRNTARDMLGMILRTHQTGPEGKVVTRVLVENGCNIGTELYISLLVDRATSK
VTVMASTEGGMDIEEVAAKTPEKIFREAIAPLVGLTPFQCRNLAFSLGLTGKLTNKAVKL
LQGLYETFIGCDCSLLEINPLVVTKEGDLLCLDAKFGFDDNAVFRHPKIGDMRDYDEEDP
NEVEASQHDLSYVSLAGNIGCLVNGAGLAMATMDIIKHSGGNPANFLDVGGGATIERVTE
AFKIILSDKNVKGILVNIFGGIMKCDVIATGVIEAAKQVSLKVPLVVRLEGTNVDKGKEI
LSASGLNIIAADGMADAANKIVQAVAAA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacatgagtatcaggcaaaggcaatactgagggaattcggggtgcccgttccg
gatgggcacgtctgctacaacggcgccagcgcccgtgaatgggcgaagcggctgagtgag
ggaccctgggtagtcaaggcccagatccatgcaggtggccgtggcaaggggggcggtgtc
aagctggcccgcaccgccgacgaggtacgaaacaccgcccgggacatgctcggcatgatc
ctgcgcacccaccagaccggaccggaagggaaggtggttacccgggtcctggtggaaaac
ggctgcaatatcggtactgaactgtacatcagccttctggtggatcgtgctacctccaag
gtgacggtcatggcctccaccgaagggggaatggacatcgaagaggttgccgccaagaca
ccagagaaaatcttccgcgaggccatcgccccgctggtgggacttacccccttccagtgc
cgcaatctggccttcagtctgggacttaccggcaagctgaccaacaaggcggtcaagctg
ctgcaggggctctacgaaacctttatcggctgcgactgctctctgttggagatcaacccc
ctggtcgtgaccaaggaaggggacctgctctgtcttgatgccaagttcggcttcgacgac
aacgccgtcttcaggcatcccaagatcggcgatatgcgggattatgacgaagaagacccc
aacgaggtggaagcatcacagcacgacctctcctatgtctccctggccggcaacatcggc
tgcctggtcaacggcgccggtctggccatggccaccatggacattatcaagcattccggc
ggcaatccggccaacttcctggacgttgggggcggggcgaccatcgagcgcgttaccgaa
gccttcaagatcatcctttccgacaagaacgtcaaaggcatcctggtcaacatcttcggc
ggcatcatgaaatgcgatgtcattgccaccggggttatcgaggccgccaagcaggtttcc
ctcaaggtgccgctggtcgttcgtctggaaggtaccaatgtggacaaaggcaaagaaatc
ctttccgccagtggtctgaatatcatcgccgccgacggcatggccgacgccgcaaataaa
atcgtccaggccgtggcagctgcctga

DBGET integrated database retrieval system