KEGG   Geobacter daltonii FRC-32: Geob_1954Help
Entry
Geob_1954         CDS       T00846                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex, E2 protein, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00010  Glycolysis / Gluconeogenesis
geo00020  Citrate cycle (TCA cycle)
geo00620  Pyruvate metabolism
geo01100  Metabolic pathways
geo01110  Biosynthesis of secondary metabolites
geo01120  Microbial metabolism in diverse environments
geo01130  Biosynthesis of antibiotics
geo01200  Carbon metabolism
Module
geo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geob_1954 (aceF)
   00020 Citrate cycle (TCA cycle)
    Geob_1954 (aceF)
   00620 Pyruvate metabolism
    Geob_1954 (aceF)
Enzymes [BR:geo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Geob_1954 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACM20311
UniProt: B9M845
Position
2190426..2191703
Genome map
AA seq 425 aa AA seqDB search
MATDITMPKLSDTMTEGRLISWKKSVGDQVERGDIIAEVETDKANMELESFGAGILLEQR
VKPGEMVPVGMVIGVVGAPGEKAEAKPEVVPEQPAAEVIPPAVDKTSKSAAQGSTGAMAG
DVPERIMELPEAREFTKPGAGDKASPRVRRLAREKGIDLTQVTGSGPEGRILQEDLARFG
VHEEKKEKRPAGEAAEQAEAPSAAGQPLSRMRTAIARKVSESWRQIPHFTVMVAVEVGEA
EKVYRELKQAGTAVTLNDIIIKAVAATIGKFPLVNASFSQTGIETHDEINIGVAVSLDEG
LVMPVIKGCQTLSVREIAARSHEVIDRARNGTIGENELSGGTFSISNMGMLGVEQFSAII
YPPQGAILAVAAALDEAVVRGGQVVPSRIMRMTLSADHRLIDGAYAARFMAELKRVLENP
VVLLI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccactgacataacaatgcccaagctgtccgacaccatgaccgaaggacgcctcatt
tcctggaaaaaatcggtgggggaccaggtagaacgtggcgacatcattgccgaagtggaa
acggacaaggcgaacatggaattggagtcgttcggtgccggcatcctgctggagcagcgg
gtaaagccgggagaaatggtgccggtgggaatggtaatcggagtggtcggggcaccgggg
gagaaggcggaagcgaagcctgaggtggtgccggagcagcctgccgccgaagtgatcccc
ccggcggtcgacaaaacctccaaaagcgcggcacaaggctccaccggtgccatggccggt
gatgttcccgaacggatcatggaattgcctgaggcgcgggaatttaccaagccaggtgcc
ggagataaggcttcgccaagggttcggcgcctggcaagggaaaaggggatcgacctgacg
caggttaccggcagtgggcccgaagggcgtatcctgcaggaagacctggcgcggtttggg
gttcatgaagagaagaaggagaaaagacccgctggggaagcggcagagcaggcagaagct
ccatcggctgccggacagccactaagccgcatgcggacagccattgcccgcaaggtgagc
gagtcctggcggcagattccccatttcactgtaatggttgccgtcgaggtcggtgaggcg
gagaaggtctaccgggagctgaagcaggccggcacggcggtaactctcaacgacatcatc
attaaagccgttgccgccaccatcggcaaatttcccctcgtcaacgcttccttcagccag
accggtattgaaacgcacgatgaaatcaatatcggtgtagcggtaagcctggatgaagga
ctagtgatgccggtaatcaaaggctgccagactctttccgtcagggaaattgccgcacgg
agtcatgaagtcatcgaccgggcccgcaatggtaccatcggcgagaacgagctcagcggc
ggtaccttttccatttccaatatgggcatgctgggggtcgaacagttttccgccatcatt
tatcctccccagggcgccatactggctgttgccgcggcattagacgaggccgtggtgagg
ggagggcaggtggttccatccagaatcatgcgtatgaccctttccgccgaccatcgcctg
atagatggcgcctatgcggctcgcttcatggcagagctgaaacgggtgctggagaaccca
gttgtcctactcatctga

DBGET integrated database retrieval system