KEGG   Gemella sp. ND 6198: CG018_00885Help
Entry
CG018_00885       CDS       T05584                                 

Definition
(GenBank) noncanonical pyrimidine nucleotidase, YjjG family
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
geq  Gemella sp. ND 6198
Pathway
geq00361  Chlorocyclohexane and chlorobenzene degradation
geq00625  Chloroalkane and chloroalkene degradation
geq01100  Metabolic pathways
geq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:geq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CG018_00885
   00361 Chlorocyclohexane and chlorobenzene degradation
    CG018_00885
Enzymes [BR:geq01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     CG018_00885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like PGP_phosphatase Hydrolase_6 HAD
Motif
Other DBs
NCBI-ProteinID: AXI26096
Position
complement(185527..186210)
Genome map
AA seq 227 aa AA seqDB search
MNLTQYKYLLFDLDDTLLDFKKAERRAFKKLLLNHNIEYSDDLFEKYITINKSLWRKLEL
GELSSKDVTKGRFKRFFSLLNKEVNDEKYDKEYRIYLAEGNQVFKGVPELLKKLAQTHKL
YIATNGVAATQRTRFKNNKLDEYFDYIFISEELGYKKPDKEFFEKVFEIIGSKNKSEVLM
IGDNLVSDILGGNNFGIDTCWINAEDIENITNIIPTYKIRSVMELIR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaacgcagtataagtatttattatttgatttagatgatacattattagatttt
aaaaaagcggaaagaagagcatttaaaaaattattgttaaaccataatatagaatatagt
gatgatttatttgaaaaatatattacaataaataaatcattgtggagaaaacttgaatta
ggagagcttagcagtaaagatgtaactaaggggaggtttaaacgtttttttagtttatta
aataaagaagttaatgatgagaagtatgataaggagtatagaatttatctggcagaaggt
aaccaagtatttaaaggagtaccggaacttttaaaaaaattagcacaaactcataaactt
tatatcgctactaacggcgtagcggcaactcaacgcacccgatttaaaaataataaacta
gatgaatattttgattatatatttatttcagaagaattagggtataaaaaacctgataaa
gaattttttgaaaaagtatttgaaataattggaagtaaaaataaaagtgaagtattgatg
ataggagataatctggtatctgacatactaggtgggaataattttggaatagatacctgt
tggataaacgcagaagatatagagaacatcacaaatataattccgacttataaaataaga
agtgtaatggagttaataagataa

DBGET integrated database retrieval system