KEGG   Gemella sp. ND 6198: CG018_03920Help
Entry
CG018_03920       CDS       T05584                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
geq  Gemella sp. ND 6198
Pathway
geq00450  Selenocompound metabolism
geq00970  Aminoacyl-tRNA biosynthesis
geq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CG018_03920
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CG018_03920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:geq01007]
    CG018_03920
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:geq03016]
    CG018_03920
Enzymes [BR:geq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CG018_03920
Amino acid related enzymes [BR:geq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CG018_03920
Transfer RNA biogenesis [BR:geq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CG018_03920
 Prokaryotic type
   Other AARSs
    CG018_03920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AXI26619
Position
864335..866332
Genome map
AA seq 665 aa AA seqDB search
MTKKTFYVTTPIYYPSGNLHIGHAYTTVACDAIARYKKLSGFDTYFLTGTDEHGQKIQQK
AQEKGISEQAYVDEMIRNIKKLWKAMDIDYSKFIRTTDDYHEKAVAEIFERLIEKGDIYL
GEYKGWYSISDEEYFTETQLKEVFRDENGNMIGGIAPSGNEVKLVSEECYFFKMSKYADR
LVKYYDEHPEFILPESRKNEMLNNFIKPGLEDLAVTRTTFDWGVKVKSNPKHVVYVWIDA
LVNYITALGYATGESEELFNKYWPADVQVVGKEIVRFHVIYWPILLMALDLPLPKKVFAH
GWFLMKDGKMSKSKGNVVDPYMLIERYGLDAARYYLLREVPFGQDGIFTPESFIERINSD
LSNDLGNLLNRTISMINKYCGGIIPKFVAPTTEFDKELIELSKEVVEDYEDYMENMQFSK
ALESVWKFISRTNKYIDQTTPWILAKDENSKAELDKVMNYLAESLRIATILISPALTNAP
KEIAKQLGINKDLLTFNTVKTFGVFKGDVKVIEKPMPIFPRFDKEVEIGYIKEQMSPKSL
ANLETEIKEEDNSFVELAEEITIDKFFETSLRVAEVLECEKVKKSSKLLKFKLDLGNHTR
RIVSGIAKYYEPTELIGKKVAIVANLKPVKLCGELSEGMILSAEKDGILRVVEISADVPN
GAEIR
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaacattttacgttacaacacccatttattatccaagtggtaatttacat
ataggtcatgcttacacaacggttgcatgtgatgcaatagctagatataaaaaattaagc
ggttttgatacttattttttaacagggactgatgagcatggacaaaaaattcaacaaaaa
gcacaggaaaaaggaattagtgaacaggcttatgttgatgaaatgattagaaatataaaa
aaattatggaaagcgatggatattgattatagcaagtttattagaacaactgatgattat
catgaaaaagccgttgcagaaatttttgaacgtcttattgaaaaaggtgatatttacctt
ggtgagtataaagggtggtattcaataagtgacgaagagtactttactgaaactcaacta
aaagaagtatttcgtgatgaaaacggaaatatgatcggaggtattgcaccaagcggtaac
gaggtaaaacttgttagtgaggaatgttacttctttaagatgagtaagtatgcagatcgt
ttggtaaaatattatgatgaacatccggagtttatcttaccggaaagtagaaaaaatgaa
atgttaaacaattttattaaaccgggattggaagacttggctgtaaccagaacaaccttt
gactggggtgtgaaagtaaaatcaaatccgaaacatgttgtatatgtatggatagatgct
ttggtaaattacattacagctttggggtatgctaccggtgagagtgaagaattatttaat
aaatactggcctgctgatgtacaagtagttgggaaagaaattgttcgtttccacgtgatt
tattggccgattttattaatggcattagatttaccactgcctaaaaaagtttttgctcat
ggttggtttttaatgaaagacggtaaaatgagtaaatcaaaaggtaatgtagtagatcca
tatatgttaattgaacgttatggtttagatgcggcacgttattacctattacgtgaagtt
ccgtttggacaggacggtattttcacaccggagagttttatagaaagaattaattcggat
ctttcaaatgatttaggaaacttgttgaacagaacaatctcgatgattaataaatactgt
ggtggtattattccgaaattcgtagcaccgactactgaatttgataaagaattaatcgaa
ttatcaaaagaagttgttgaagattatgaagattatatggaaaatatgcaattttctaaa
gcgttggaatctgtttggaaatttatttcaagaactaataaatatattgaccaaacaaca
ccgtggattttggcaaaagacgaaaatagtaaagcagaacttgataaggtaatgaattac
ttggcagaaagtttgagaatagcaaccattctgattagtccggcattaacgaatgcacct
aaagaaattgcaaaacaattagggattaataaagatttattaacatttaatacggtaaaa
acattcggtgtttttaaaggtgatgtaaaagtaattgaaaaaccgatgccgatattccca
cgttttgataaagaagttgaaattgggtacattaaagagcaaatgtcaccaaaatcattg
gcaaatttggaaacagaaataaaagaagaagataattcttttgttgaattagcggaagaa
attaccattgataaattttttgaaacatcattaagagtagcagaagtattggaatgtgaa
aaagtgaaaaaaagttctaaactattgaagttcaagctggatttaggaaatcatacacgt
agaatcgtttcgggtattgccaagtattatgaaccgacagagttaatcggtaaaaaagta
gcgattgttgcaaatttaaaaccagttaaattgtgtggagaattaagcgaaggaatgatt
ttatcagcagaaaaagatggaatactaagagtagtggaaattagtgctgacgttccaaat
ggtgcagaaataagataa

DBGET integrated database retrieval system