KEGG   Gemmata sp. SH-PL17: VT84_22260Help
Entry
VT84_22260        CDS       T04358                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase LhgO
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
ges  Gemmata sp. SH-PL17
Pathway
ges00310  Lysine degradation
ges01100  Metabolic pathways
ges01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ges00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    VT84_22260 (lhgO)
Enzymes [BR:ges01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     VT84_22260 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Lycopene_cycl Thi4 Pyr_redox Pyr_redox_2 FAD_binding_2 Mqo NAD_binding_7 Amino_oxidase Pyr_redox_3 HI0933_like PTH2
Motif
Other DBs
NCBI-ProteinID: AMV27142
UniProt: A0A142XKF1
Position
complement(5264502..5265701)
Genome map
AA seq 399 aa AA seqDB search
MQTSDLVVVGGGIVGLATAYQFTKRCPDKRVVVLEKEDRVAVHQTGHNSGVLHSGIYYKP
GSLKAINCRAGKKAMETFCAEEGIAHEICGKVIVAVSDADLPALNRIYERGQANGINCAL
VDKARLAELEPHASGVAAIHVPEAGIVNYRQVCERLAEKVRIAGGAVVFGAKVTSVHRKP
DGVTVVSSGGEFIASQLVNCAGLHSDRVARLTGQNPGAQIVPFRGEYFELKPSAYRLCRN
LIYPTPDPQFPFLGVHFTRMIDGSVECGPNAVLAFGREAYSFFRLNPRDLLETLTYRGFV
RMGAKHWKMGLGEMWRSLSKAAFVRALQRLVPEITADDLEPAPAGIRAQAVAPDGGLVDD
FLIQEADRVVNVCNAPSPAATASLRIGETIVDRVAPRFV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgagtgatttggttgttgttgggggcgggatcgtcgggctggcaacggcctac
caattcaccaaacggtgccccgacaagcgggtcgttgtgctggaaaaagaggatcgggtc
gcggttcaccagaccggccacaactccggtgtccttcactcgggcatttactacaagccc
ggttcgctcaaagcgatcaactgtcgcgcgggcaagaaggcgatggagaccttctgtgcg
gaagaggggatcgctcacgagatttgcggcaaggtgatcgtcgccgtatccgacgcggac
ctgcccgcactcaaccgcatctacgagcgcgggcaggcgaacggcatcaactgcgcgctc
gttgacaaggcccggctcgcggaactggaaccgcacgcgagcggtgtggccgcgatccac
gttcccgaagcggggatcgtgaactaccgccaggtgtgcgagcgccttgccgagaaggtg
cgcatcgcgggtggggccgtggtgttcggcgcaaaagtcacctccgttcatcgcaaaccg
gacggcgtgacggtcgtgagtagcgggggagagttcatcgcctcccaactggtgaattgc
gccgggttgcattcggaccgcgtcgcgcggctcacggggcagaatcccggcgcgcagatc
gtgccgtttcgcggggaatacttcgagctgaaaccgtccgcgtaccggttgtgccggaac
ctgatttatccgaccccggacccgcagttcccgttcctcggggtccacttcacgcggatg
atcgacgggtccgtcgagtgcggacccaacgcggtgctcgcgttcgggcgcgaggcgtac
tcgttcttccggctgaacccgcgtgacctgctcgaaacgctcacttaccgcgggttcgtt
cggatgggggcgaaacactggaagatgggcctcggcgaaatgtggcggtcgctgagcaag
gccgcgttcgttcgcgcgcttcagcgcttggtgccagagatcaccgccgacgatctggaa
ccggcgccggctggtatccgcgctcaggccgtagcgccggacggcggactggtggacgat
ttcctcattcaagaagccgatcgcgtggtgaacgtctgcaatgcaccgtcgcccgcggcc
accgcgtcgctccggatcggtgaaacgatcgtggaccgggtcgccccgcgttttgtgtag

DBGET integrated database retrieval system