KEGG   Gemmata sp. SH-PL17: VT84_24845Help
Entry
VT84_24845        CDS       T04358                                 

Gene name
inhA
Definition
(GenBank) Isonitrile hydratase
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
ges  Gemmata sp. SH-PL17
Pathway
ges00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:ges00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VT84_24845 (inhA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ges01002]
    VT84_24845 (inhA)
Enzymes [BR:ges01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     VT84_24845 (inhA)
Peptidases [BR:ges01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   VT84_24845 (inhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI GATase DUF2069
Motif
Other DBs
NCBI-ProteinID: AMV27652
UniProt: A0A142XLT2
Position
5830830..5831642
Genome map
AA seq 270 aa AA seqDB search
MQTRRHFIRVALTGTVAAGGCGARHEPATDTPNEEQNMADHLNVGMLVFPRMDQVDLTGP
FAVLSRLPNASVQLLWKDTKPVRDYRGLGLMPDARLTEAEPVDLLVVPGGPGQEDLMEDE
GVLSFITQQAARAKCVFSVCTGALVCGAAGLLKGRSATTHWRSVHLLKYFGAVAKDQRVV
VDGTFVSAAGLTAGIDGALRVAELLRGSDSAKAIQLDLQYAPEPPFDCGHPDKAPAELVA
KLKGATEKLTAQRLVTAKRAAARLKVPVED
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactcgcaggcacttcatccgtgtcgccctaacgggcactgttgctgcaggcggg
tgtggcgcgcgccacgaaccggccacagataccccgaacgaggaacagaatatggcggac
cacctgaacgtcgggatgctcgtatttccccggatggaccaggtggacctgaccggcccg
tttgcggttctgtcccgtttgccgaacgcatccgtccaacttctctggaaggacacgaaa
ccggtgcgagattaccgagggttgggccttatgccggacgcccgtttgaccgaagcggaa
ccggtcgacctgctggtcgtacccggtggcccgggccaggaagatctgatggaagacgag
ggcgttctctcgttcatcacccaacaggccgcgcgagcaaaatgcgtgttctcggtgtgc
accggagcactcgtttgcggtgcggccgggttgctcaaggggcggtccgcgacgacgcac
tggcgctcggtccacctgttgaagtatttcggggccgtggcgaaggaccagcgggtagtc
gtagacggaacgttcgtgagtgcggccgggcttacggccgggatcgacggggcgctgcgg
gtggccgaattgttacgcggctcggactctgcaaaagcgatccaacttgatctccaatac
gcaccggaacccccgttcgattgcggacaccccgacaaggcccccgccgaactcgtcgcg
aaactgaagggagcgacggagaagttaacggcgcaacggctcgtgacggctaagcgggcc
gcggcccggctcaaagttccggtcgaggattaa

DBGET integrated database retrieval system