KEGG   Gemmata sp. SH-PL17: VT84_32625Help
Entry
VT84_32625        CDS       T04358                                 

Gene name
phhA
Definition
(GenBank) Phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
ges  Gemmata sp. SH-PL17
Pathway
ges00360  Phenylalanine metabolism
ges00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ges00790  Folate biosynthesis
ges01100  Metabolic pathways
ges01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ges00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    VT84_32625 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VT84_32625 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VT84_32625 (phhA)
Enzymes [BR:ges01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     VT84_32625 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AMV29185
UniProt: A0A142XQN0
Position
7639597..7640496
Genome map
AA seq 299 aa AA seqDB search
MNESPNTLVEYGSVIDAHQMVEPPDTTELELEPGHPGEHDAEYIARRKGLFALTRKHRLE
KLGPPFVTYTPEETRIWREVSPKLDELHRKYACEIYLRAKDDLAITQTEIPQLRTLSERV
QRETNMHLVPAEGALPYRTFYEYIAQRGFPVTQFIRHGSHPEFTPEPDMIHDCLGHVPPL
MNQDYAELLTLIGKAAASTPHGDQVLALKRFSWFSIEFGLIEERGETKVFGAGILSSTGE
IPHALFSPNATRRPFVTETVISTDYDPSQMQKDFFIAPSLPFLRRELESLVRRFNIPVL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatcaccgaacacgctcgtcgagtacggctcggtcatcgacgcgcaccagatg
gtcgaaccacccgataccaccgaactggaactcgaacccgggcaccccggcgaacacgac
gcggagtacatcgcccggcgtaagggactgttcgcgctcacccgcaagcaccggctcgaa
aagctgggaccgccgttcgtgacgtacacgcccgaagaaacgcggatctggcgcgaggta
tcgccgaagctcgacgagttgcaccgcaagtacgcttgcgaaatctatttgcgtgcgaag
gacgatctggcgatcacgcagaccgaaatcccgcaactccggacgctgagcgagcgcgtg
cagcgcgaaacgaacatgcacctcgtccccgcagagggggcgttaccgtaccggacgttc
tacgagtacatcgcccagcgcgggttcccggtcacgcagttcatccggcacgggtcgcac
cccgagttcacgccggaaccggacatgatccacgactgcttggggcacgtcccgccgctc
atgaaccaggactacgcagagctgctcacgctcatcggcaaggccgcggccagcacgccg
cacggcgatcaggtactcgcactgaagcgctttagttggttcagcatcgaattcgggctg
atcgaggagcgcggtgaaacgaaggtattcggagccggtatcctttcgagcacgggcgag
atcccgcacgcgctgttctccccgaacgcgacccggcgcccgttcgtcacggaaaccgta
atttccacggactacgatccgtcgcagatgcagaaagacttcttcatcgccccgtcgctc
ccgtttctgcgccgggaactagagtcgctcgtgcggcggttcaatatccccgtactgtga

DBGET integrated database retrieval system