KEGG   Georgenia sp. Z294: FE251_04945Help
Entry
FE251_04945       CDS       T06026                                 

Gene name
fdhA
Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
gez  Georgenia sp. Z294
Pathway
gez00625  Chloroalkane and chloroalkene degradation
gez00680  Methane metabolism
gez01100  Metabolic pathways
gez01120  Microbial metabolism in diverse environments
gez01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gez00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    FE251_04945 (fdhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FE251_04945 (fdhA)
Enzymes [BR:gez01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     FE251_04945 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N AlaDh_PNT_C ADH_zinc_N PALP FAD_binding_2 2-Hacid_dh_C FAD_binding_3 GIDA Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: QDB78795
UniProt: A0A5B8AQC9
Position
1107018..1108223
Genome map
AA seq 401 aa AA seqDB search
MAGNRAVAYKGPGTVEVIEIDYPTFELKDGPGVNPANVGRKVPHGVILKTVATNICGSDQ
HMVRGRTTAPPDLVLGHEITGEVVETGPDVEFVRKGDLVSVPFNISCGRCRNCKARRTEI
CLNVNPDRPGSAYGYVDMGGWVGGQAEYVLVPYADWNCLVFPDRDQAMEKILDLAMLSDI
LPTGYHGAYSAGVTTGSTVYVAGAGPVGLAAAASAQLLGASVVVVGDFNAERLAQARSFG
CETIDLAKGQPHEQMEQVIGDPFVDAAVDAVGFEAKGHEGKEAPATVLNSVMMVADAGAA
VGIPGLYVTGDPGGVDESAKRGALSLDFGTGWAKALSFVTGQTPVMKYHRDLMKAILRDR
LHIAKAVNAEVISLDDAPRGYAEFDKGAARKYVIDAHGSLG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggctggcaacagagcggttgcgtacaagggccccggcaccgtcgaggtcatcgagatc
gactacccgacgttcgagctcaaggacgggccgggggtcaatcccgcgaacgtcgggcgc
aaggtcccccacggcgtcatcctcaagacggtcgccacgaacatctgcggctcggaccag
cacatggtccgcgggcgcaccaccgccccgcccgacctcgtcctgggccacgagatcacc
ggcgaggtcgtcgagaccggccccgacgtcgagttcgtcaggaagggcgacctcgtctcg
gtgccgttcaacatctcctgcgggcgctgtcgcaactgcaaggcccggcgcaccgagatc
tgcctcaacgtcaaccccgaccggccgggcagtgcctacggctacgtcgacatgggggga
tgggtcggcgggcaggcggagtacgtcctggtcccctacgcggactggaactgcctcgtc
ttccccgaccgggaccaggcgatggagaagatcctcgacctcgcgatgctgtcggacatc
ctgcccaccggttaccacggcgcctacagcgccggggtgaccaccgggtcgacggtgtac
gtcgcgggagcaggccccgtcgggctcgcggcagcggcctcggcacagctgctcggggcg
tcggtggtcgtcgtcggtgacttcaacgccgagcgcctcgcccaggcccgcagcttcggc
tgcgagacgatcgacctcgccaaggggcagccgcacgagcagatggagcaggtcatcggc
gacccgttcgtcgacgccgccgtcgacgcggtcggcttcgaggcgaagggccacgagggc
aaggaggccccggcgaccgtcctcaacagcgtgatgatggtggccgacgccggggccgcc
gtcggcatccccgggctgtacgtcaccggtgacccgggcggcgtcgacgagtccgccaag
cgcggtgcgctctcgctcgacttcggcaccggctgggccaaggcgctgtccttcgtcacc
ggccagaccccggtgatgaagtaccaccgcgacctcatgaaggcgatcctgcgcgaccgg
ctgcacatcgcgaaggcggtcaacgccgaggtcatcagcctcgacgacgccccgcgcggc
tacgccgagttcgacaagggggcggcgcgcaagtacgtcatcgacgcgcacggctcgctg
ggctga

DBGET integrated database retrieval system