KEGG   Georgenia sp. Z294: FE251_08575Help
Entry
FE251_08575       CDS       T06026                                 

Definition
(GenBank) hypothetical protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
gez  Georgenia sp. Z294
Brite
KEGG Orthology (KO) [BR:gez00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gez03009]
    FE251_08575
Enzymes [BR:gez01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     FE251_08575
Ribosome biogenesis [BR:gez03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    FE251_08575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 PCMT
Motif
Other DBs
NCBI-ProteinID: QDB79417
UniProt: A0A5B8ASF8
Position
1921027..1921878
Genome map
AA seq 283 aa AA seqDB search
METPLDLVMDRLRCPVCTETLTRTERTVRCAAGHAFDIARQGYLTLLGGARPAVQGDTAD
MVAARTAFLAAGHYEPVARALAEAVRDVPAADDADHPLVLDLAGGTGYYLATVLDALPRA
LGVDVEISPYASRRAARAHPRLAAVRADVWQPLPLAAGSAAAVLSVFGPRNPAEIARVLT
PGGRLVVVAPAQDHLAEIIGPLGMLTVAPDKEARLARQLADFTTTAERAVRYRATLTHAD
VVHEALMGPSAHHLDRDELLAAVAALPEPLAVTVSVTVSVHRA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcccctcgacctcgtgatggaccggctgcgctgcccggtgtgcaccgagacg
ctgacccggaccgagcgcacggtgcggtgcgcggcggggcacgccttcgacatcgcccgg
cagggctacctcacgctgctcgggggcgcacggccggcggtccagggcgacaccgccgac
atggtcgcggcgcgcactgcgttcctcgccgccgggcactacgagccggtcgcccgcgcc
ctcgccgaggcagtccgcgacgtccccgcggccgacgacgccgaccacccgctcgtcctc
gacctggccggtggcaccggctactacctcgccaccgtgctggacgccctcccccgggcg
ctcggcgtcgacgtcgagatctccccgtacgcgtcccggcgcgccgcccgggcccacccg
cgcctggcggcggtccgcgcggacgtgtggcaaccgctcccgctcgccgcaggctcggcc
gcggcggtgctcagcgtcttcggcccgcgcaacccggcggagatcgcccgcgtgctcacg
cccggggggcggctggtggtcgtcgcgccggcgcaggaccacctcgccgagatcatcggc
ccgctcgggatgctcacggtggccccggacaaggaggcccggctggcccgtcagctcgcc
gacttcacgacgacggcggaacgggccgtgcgctaccgcgcgacgctcacgcacgcggac
gtcgtgcacgaggcgctcatgggccccagcgcccaccacctcgacagggacgagctcctc
gcggccgtcgccgcactgccggagccgctcgcggtgacggtctcggtcaccgtgtcggtc
caccgggcctga

DBGET integrated database retrieval system