KEGG   Georgenia sp. Z294: FE251_09855Help
Entry
FE251_09855       CDS       T06026                                 

Definition
(GenBank) G/U mismatch-specific DNA glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
gez  Georgenia sp. Z294
Pathway
gez03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gez00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    FE251_09855
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gez03400]
    FE251_09855
Enzymes [BR:gez01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     FE251_09855
DNA repair and recombination proteins [BR:gez03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     FE251_09855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: QDB79645
UniProt: A0A5B8ASL5
Position
2230486..2231040
Genome map
AA seq 184 aa AA seqDB search
MPAHGRPTRDELAAAADRTLPTLLAPGLRVLFCGINPGLYSAWTGHHFARPGNRFWPALH
RSGFTPRQLAPAEQEELLALGLGLTNVVERASATAAELSAEELHAGGRRLVDDVVTYEPQ
WLAVLGVTAYRTAFDRPRATYGEQPERLGRTRVWVLPNPSGLNAHVTPPQLAAAFGELRL
AVEG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcccacggtcgccccacccgcgatgagctcgccgccgcggcggaccgcaccctg
ccgacgctcctcgccccagggctgcgcgtgctgttctgcgggatcaacccggggctgtac
tcggcctggaccggccaccacttcgcccggccggggaaccggttctggccggcgctgcac
cgctcgggcttcaccccgcggcagctcgcgcccgccgagcaggaggagctgctcgccctg
ggactggggctgacgaacgtcgtggagcgcgcctcggcgaccgcggccgagctctccgcc
gaggagctgcacgccgggggacggcggctggtcgacgacgtcgtgacctatgagccgcag
tggctcgccgtcctcggggtgaccgcctaccgcacggccttcgaccggccgcgtgcgacg
tacggggagcagccggagcggctggggcggacgcgggtgtgggtgctgcccaacccgagc
gggctcaacgcccacgtcactccgccccagctcgccgcggccttcggcgagctgcggctc
gccgtcgagggctga

DBGET integrated database retrieval system