KEGG   Georgenia sp. Z294: FE251_15245Help
Entry
FE251_15245       CDS       T06026                                 

Definition
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
gez  Georgenia sp. Z294
Pathway
gez00260  Glycine, serine and threonine metabolism
gez01100  Metabolic pathways
gez01110  Biosynthesis of secondary metabolites
gez01120  Microbial metabolism in diverse environments
gez01130  Biosynthesis of antibiotics
gez01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gez00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FE251_15245
Enzymes [BR:gez01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FE251_15245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 NIR_SIR_ferr
Motif
Other DBs
NCBI-ProteinID: QDB80573
UniProt: A0A5B8AVT7
Position
3426673..3427704
Genome map
AA seq 343 aa AA seqDB search
MTTRGFTSDNASGAHPAVLAALVAANEGHAPSYGADALTAELAERTREVFGPDAAIFPVL
NGTGANVVALTALLQRWDAVVAAELAHVATDESTAPQLVGGFALRTLPAPGGRIDPEDLT
ALLAAQDGSVHHARPAALTLTQSTELGTVYTPAELARLTGLAHAHGLAVHVDGARLANAA
ARLGTSLRELTTDVGVDVLSFGATKNGALFGDAVVVTDPALAEPVARLRKASTQLASKMR
FVSAQLLALLTDDLWRTTAAQANDAADHLAQRLREDLGIEPVHPVQANAVFLPVPPERLD
DVLAQVPVLPWDRRTGLLRAVCSFDTTEEDVAALVTGLRRVLG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgcggcttcacctccgacaacgcctccggcgcccaccccgccgtgctcgcg
gcactcgtcgccgcgaacgagggccacgccccctcctacggcgccgacgccctcaccgcc
gagctcgccgagcgcacccgggaggtcttcggccccgacgccgcgatcttccccgtcctc
aacggcaccggcgccaacgtcgtggccctcaccgcgctgctccagcggtgggacgccgtc
gtggccgcagagctcgcccacgtcgccaccgacgagtcgaccgcgccccagctcgtgggc
ggcttcgccctgcgcaccctgccggcgcccggcggccggatcgacccggaggacctcacc
gccctgctcgcggcgcaggacggcagcgtccaccacgcccgccccgccgcgctcaccctc
acccagagcaccgagctcgggaccgtctacaccccggcggagctcgcccggctcaccggc
ctcgcccacgcgcacggcctggccgtccatgtcgacggcgcgcggctggccaacgccgcc
gcccgtctcggcacgtcgctgcgcgagctgaccaccgacgtcggcgtcgacgtgctgtcc
ttcggcgcgacgaagaacggcgcgctgttcggggacgccgtcgtcgtcaccgacccggcc
ctcgccgagccggtcgcccggctgcgcaaggcgagcacccagctcgcctcgaagatgcgg
ttcgtctcggcccagctcctcgcgctgctcaccgacgacctgtggcgcacgacggcggcc
caggccaacgacgccgcggaccacctggcgcagcggctgcgcgaggacctcggcatcgag
ccggtccatccggtccaggccaacgccgtcttcctgcccgtcccgcccgagcgcctggac
gatgtcctcgcccaggtgccggtcctcccgtgggaccgtcgcaccggcctgctgcgggcg
gtgtgctccttcgacacgaccgaggaggacgtcgccgcgctcgtcaccggcctgcgccgc
gtcctcggctga

DBGET integrated database retrieval system