KEGG   Geosporobacter ferrireducens: Gferi_05165Help
Entry
Gferi_05165       CDS       T04493                                 

Definition
(GenBank) nicotinate-nucleotide adenylyltransferase
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
gfe  Geosporobacter ferrireducens
Pathway
gfe00760  Nicotinate and nicotinamide metabolism
gfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Gferi_05165
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gfe03000]
    Gferi_05165
Enzymes [BR:gfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     Gferi_05165
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     Gferi_05165
Transcription factors [BR:gfe03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    Gferi_05165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 AAA_18 Ras CTP_transf_like AAA_15 ABC_tran RNA_helicase MMR_HSR1 Roc G-alpha PduV-EutP AAA_24 DUF3047 AAA AAA_14
Motif
Other DBs
NCBI-ProteinID: AOT69000
UniProt: A0A1D8GDL1
Position
complement(1013208..1014236)
Genome map
AA seq 342 aa AA seqDB search
MNSVGFIGGKFLPLHMGHVYAIVKAACMCDELYVVLSYSKARDAALCKDLKVKEMSREIR
HRWLTQLTRDMENVRVIKVEDTYDSDETYNWEEGAWQIKKAIGKPINYIFSSENSYGEIF
TRLYPEAKHVVIDSARHRYPISATKIRAEGVYKHWEMLPDFVRSYFIKKVVIVGTESCGK
STLTQYLAKLYNTTYVEEYGRTICEELGGYEDILTKDIFSQIAYKHKVLEYEAYKKANKV
VFIDTEAIVTQYYSELCLGESNPVVDSVAEDQDYDLWIYLEPDVQWVNDGLRTYGEEKTR
HENNLKLKEMLKNRKIEFVSVRGTYIERLNKSVDLVNKLLEI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgttggctttatagggggaaaattcttaccgctgcatatggggcatgtttat
gctattgtaaaggcagcttgcatgtgtgatgaattatatgtggtcttatcctatagtaag
gctagggatgccgcattgtgtaaagacttaaaagtaaaagaaatgtcccgggagataagg
catagatggttaacacagctgacaagagatatggaaaatgttcgggtgataaaagtagaa
gatacgtacgatagcgatgaaacctataattgggaagaaggagcctggcaaattaaaaaa
gctataggaaaacccattaattatatcttcagttcagaaaatagctatggagaaattttt
acaagattatatccggaagcaaaacatgtggttatagacagcgcaagacacagatatccc
atttcggcaacaaaaataagagctgaaggagtgtataagcattgggagatgcttcctgat
tttgtaaggtcatattttattaaaaaagtagtcatagtaggaactgaaagttgcggaaaa
tccacactgacgcaatatctggcaaagctttataacacaacctatgtagaagagtatggc
cggacaatatgcgaagaattgggaggttatgaagatatccttacaaaagatattttttcg
caaattgcttataaacataaagtgttagaatatgaagcgtacaagaaagccaacaaagtg
gtctttattgatacagaagccattgttacccaatattattcagagttatgtcttggagaa
agtaatcccgtagtggatagtgtagctgaagatcaagactatgatttgtggatctacttg
gaaccggatgttcaatgggttaatgatggactgcgaacatatggtgaagagaaaaccaga
catgagaataatctaaaactcaaagaaatgctaaaaaacagaaaaattgaatttgtcagt
gtgcgtggaacttatatagaaagattaaataaatctgtagatctagtaaataagctctta
gaaatttga

DBGET integrated database retrieval system