KEGG   Geosporobacter ferrireducens: Gferi_10190Help
Entry
Gferi_10190       CDS       T04493                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gfe  Geosporobacter ferrireducens
Pathway
gfe00071  Fatty acid degradation
gfe00072  Synthesis and degradation of ketone bodies
gfe00280  Valine, leucine and isoleucine degradation
gfe00310  Lysine degradation
gfe00362  Benzoate degradation
gfe00380  Tryptophan metabolism
gfe00620  Pyruvate metabolism
gfe00630  Glyoxylate and dicarboxylate metabolism
gfe00640  Propanoate metabolism
gfe00650  Butanoate metabolism
gfe00900  Terpenoid backbone biosynthesis
gfe01100  Metabolic pathways
gfe01110  Biosynthesis of secondary metabolites
gfe01120  Microbial metabolism in diverse environments
gfe01130  Biosynthesis of antibiotics
gfe01200  Carbon metabolism
gfe01212  Fatty acid metabolism
gfe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gferi_10190
   00630 Glyoxylate and dicarboxylate metabolism
    Gferi_10190
   00640 Propanoate metabolism
    Gferi_10190
   00650 Butanoate metabolism
    Gferi_10190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Gferi_10190
   00072 Synthesis and degradation of ketone bodies
    Gferi_10190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gferi_10190
   00310 Lysine degradation
    Gferi_10190
   00380 Tryptophan metabolism
    Gferi_10190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Gferi_10190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gferi_10190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Gferi_10190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gfe04147]
    Gferi_10190
Enzymes [BR:gfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Gferi_10190
Exosome [BR:gfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gferi_10190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AOT69919
UniProt: A0A1D8GG95
Position
complement(2134047..2135219)
Genome map
AA seq 390 aa AA seqDB search
MKNAVIVSAVRTPVGRFRGALSSVEPYKMGAEVIKESIKRSDIDKAMIDEVIFGNLMGHD
VNNIARMASLEAGIPIEKPALTVDRQCGTSLNAIALGAMMIQLGEAKVIVAGGVESDSRR
PYIMLKQEAGYSHTPPKFSHDLRLSPEHIGNPNMGITAENLVSMYQLTREELDVYSYNSH
KKAALAEEKGKFTEQILPIEVDKGKGKKEMVSKDETIREGISLEAMAKLKPVFKEDGVVT
AGNSSPMSDGAAAVVIMEEEMAKELGLEILARYRAFTAVGVDPNIMGIGPVPATRKILEK
TNLTLDDIDLIELNEAFAAQTVACIKELGIDENKLNVNGGAIALGHPLAGTGAILTTKMV
YEMRDRDAHLGLITFCCGGGQGVAMLLERD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgctgtaatagtttcggctgttcgtacacctgtaggtagattcaggggcgct
ttatcatctgtagaaccatataaaatgggagctgaagtgattaaagaatctattaagaga
tctgatattgataaggctatgatagacgaggttatttttggtaatttgatgggacatgat
gtaaataatatagcaagaatggcatcattagaggcaggaatacctatagaaaagccagca
cttacagtagatagacaatgtggtacatctcttaatgctattgcattgggagcaatgatg
attcaattgggagaggcgaaagtaatcgttgctggaggcgttgaaagtgactcccgtaga
ccgtatatcatgctgaaacaggaagcagggtattcacatacgccccctaaatttagccat
gatctaaggctttcaccggaacatatagggaatcccaatatgggtataactgctgagaat
cttgttagcatgtatcagcttacaagagaagaattggatgtctattcctataatagccat
aaaaaagctgctttagcagaagaaaaaggtaaatttacagaacagattttacctatagaa
gttgataagggaaaaggtaagaaagaaatggtttcaaaagatgaaactataagagaaggc
attagcttagaggcaatggctaaattgaaaccagtttttaaggaagatggtgtagtaaca
gcaggaaatagttcacctatgagcgatggagctgctgcagtagtaatcatggaggaagaa
atggcgaaagagctagggctagaaatattagcaagatatagagcctttactgctgtaggt
gtagatcctaatatcatgggaataggtcctgttccggctactagaaaaattttagaaaag
acaaatttgactttagatgatattgatttaattgaattaaatgaggcttttgctgctcag
acagtagcttgtataaaggaattaggcatagacgaaaacaagttaaatgtgaatggtggt
gcaatagcccttggtcatccattggcaggaacaggggctattttaacaacgaaaatggtt
tatgaaatgagagatagagatgctcatttaggtctaataaccttctgctgcggcggagga
caaggcgtagccatgttgttagagagggattag

DBGET integrated database retrieval system