KEGG   Geosporobacter ferrireducens: Gferi_15650Help
Entry
Gferi_15650       CDS       T04493                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
gfe  Geosporobacter ferrireducens
Pathway
gfe00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:gfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Gferi_15650
Enzymes [BR:gfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Gferi_15650
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Gferi_15650
    1.1.1.-  
     Gferi_15650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 NAD_binding_3 Sacchrp_dh_NADP Shikimate_DH F420_oxidored NAD_binding_7 2-Hacid_dh_C TrkA_N ThiF
Motif
Other DBs
NCBI-ProteinID: AOT70864
UniProt: A0A1D8GIY7
Position
complement(3346797..3347855)
Genome map
AA seq 352 aa AA seqDB search
MKAAVWYGKKDVRIMDVPEPSAPGEGKVKIKVHWCGICGSDLHEYLVGPIFIPTTEPHPL
TGDVAPVILGHEFSGEIVEIGPGVTNFKVGDRVAPDACQVCHKCYACKIGKYNVCDQLAF
TGLMTNGAFAEYVVVPEYTLYKIPDNMSYETAALLEPLAVGVHAVRQAPIALGESVVIFG
AGTIGLATLQAVRAAGVSKIYVVEVAKARKDFAKQLGATEVFDPTKMDIKEKIKEVTKGV
GADVVFECIGSHKVTPIAVEIARAGGKIVIVGVYEKETSLNFNNVVFKDKHIIGSLAYAG
DFAIAIDLINDGRINVEPLITGKIRIDDLIEKGFDELVNRKEENIKIIVTPW
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcagtatggtatggaaaaaaagatgttagaattatggatgttcctgagcca
tcagcgccaggagaaggaaaggttaagattaaagttcactggtgtggcatctgtggttct
gacttacacgaatacttagtggggcctatttttatcccaacgacagagccccatccttta
acaggtgatgtagcccctgttattcttggtcacgaattttctggagaaatcgtagagata
ggtccaggtgttacaaactttaaagtaggagatcgagttgctcctgatgcttgtcaagtt
tgtcataagtgctatgcctgtaaaatcgggaagtacaatgtatgtgatcagctagccttc
acgggattaatgacaaatggggcctttgcagaatatgttgtagttccagaatacaccctt
tataagataccagacaatatgtcctacgagacagctgctttgcttgaaccccttgcggta
ggtgttcatgctgtacgacaggcaccaattgccctgggagaaagtgtagtaatctttggt
gcaggtaccatcggattagcaacccttcaagcagttcgtgcagctggtgtcagtaaaata
tatgttgttgaggtagcaaaagcaagaaaagattttgcaaagcagttgggagctactgaa
gtttttgatccgaccaaaatggacattaaggaaaagattaaggaagtcacgaagggtgta
ggagcagacgttgtctttgaatgcatcggcagtcataaagtaacccctatagctgtagaa
atagcaagggccggtggaaagattgtaatagtaggggtttatgaaaaagaaacaagtcta
aatttcaataatgttgtttttaaagataagcatattatcggttctctagcttatgcaggg
gatttcgctatagccattgatttaatcaatgatggacgtatcaatgttgagcctttgatt
acaggaaaaattagaattgatgatttaatagaaaagggatttgatgaattagttaaccga
aaggaagaaaatattaaaattattgttacaccatggtag

DBGET integrated database retrieval system