KEGG   Geosporobacter ferrireducens: Gferi_26745
Entry
Gferi_26745       CDS       T04493                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
gfe  Geosporobacter ferrireducens
Pathway
gfe00472  D-Arginine and D-ornithine metabolism
gfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Gferi_26745
Enzymes [BR:gfe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Gferi_26745
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AOT72840
UniProt: A0A1D8GPF7
Position
5694623..5694988
AA seq 121 aa
MKRADDFQQRRTHLANLTDEQLKERFWQLAEKIVDPMIDLAYKNTTPSIERSVLLRMGFS
SLEAKAIVEGVMDRGLMGKGAGHVVYRLAKEKNLQIREAGLALVEGKYWDEIAAMFQGGA
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaaaagagcagatgattttcaacagcgtagaacccatttggccaatcttaccgatgaa
cagctaaaggaaagattttggcagctggcagaaaaaattgttgatccgatgattgatctg
gcctataagaatactaccccatctattgagagatccgtactgcttcgaatgggattctcc
agtctcgaagcaaaggcgatcgtagaaggcgtaatggatcgtggtttaatgggaaaaggt
gctggtcacgttgtatataggttagcaaaggaaaagaatctacaaatccgagaagctgga
ttagctctagtagagggtaagtactgggatgaaattgcagctatgtttcaaggaggtgca
aaataa

DBGET integrated database retrieval system