KEGG   Geosporobacter ferrireducens: Gferi_26750
Entry
Gferi_26750       CDS       T04493                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
gfe  Geosporobacter ferrireducens
Pathway
gfe00472  D-Arginine and D-ornithine metabolism
gfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Gferi_26750
Enzymes [BR:gfe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Gferi_26750
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AOT72841
UniProt: A0A1D8GPG5
Position
5694988..5697198
AA seq 736 aa
MELKINEKIDVKEILKDLESYRPKRRGWTWRENEENLQMGPFTYKNCSKPLKNSVPLPSA
KYFGDIDPQPDYTITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHFDGLIEGTP
QGIGGIPITRKQVRAQRKALDLIEEEVGRPINYHSYVSGVAGPDIAVMFAEEGVNGAHQD
PQYNVLYRNINMIRSFVDAAESKKIMSWADMAQIDGAHNANATAREAWKVMPELMVQHAL
NSIYSVKVGMKKTNICLSTVPPTAPPAPSMHLDLPYAVALRDLFSEYRMRAQMNTKYMES
STREATVTHVLNLMISRLTSADIQSTITPDEGRNVPWHIYNMEACDTAKQALVGMDSLME
MIELKKEGYLPEKVRELKERAVLFMEEIIEAGGYFKAVEQGFFVDSGHYPERNGDGIARK
IDGGIGVGAIYERDTDYLAPVTAHFGYNNVKQYDETAEDQPSKLINGSTLEAPEKIIYID
ELDDTDNVNVRMEETKELRESSKILPEVEWMGDGIVQLDLFLPASKRVAEFAALEMGKKM
GLEDVEVIHKEIMHPSEGTRIQLKGRVAFAIDTKDLVIPPEPEIMSEQEVREAIEAQPMK
IVAGTVGEDEHSVGLREIIDIKHGGIEKYGIECHYLGTSVTLEKLVDAAIELNADAILAS
TIISHDDIHYRNMKRIHELCIEKGVRDKIMILCGGTQVTPELAVKQGIDAGFGRGTKGIH
VATFLVKRRSEMKDEN
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggagctaaaaatcaatgagaaaattgacgtaaaagaaattttgaaggatttagaaagc
tacagaccaaagagaagaggctggacgtggagagaaaatgaggaaaatcttcaaatgggg
ccttttacgtacaaaaactgctctaaacctcttaaaaacagtgtaccgcttccatctgcc
aagtattttggagatattgatccacaaccggattatacgattactacggaaatcgcttcc
ggcagatttgaagatgacattcgtcgtatgagaatggctgcatggcatggtgcagatcat
atcatggttatccgtacggctggccaatcccactttgatggtttaattgaaggtacccct
caaggtattggtggaattccaattacgaggaaacaagtaagagcacaaagaaaagcattg
gacctaattgaggaagaagtaggcagaccgattaattatcattcctatgttagtggtgtg
gctggcccggatatcgctgtcatgtttgcagaagaaggtgttaatggcgcccatcaagat
ccgcagtataacgtattatatagaaacatcaacatgattcgttcttttgttgacgctgcc
gaatctaaaaaaatcatgtcatgggcagatatggcacagatcgatggtgcacataatgca
aatgccactgcaagagaagcttggaaggttatgccggagttgatggttcagcatgcgcta
aattccatatattctgtaaaagtaggtatgaagaagacgaatatttgtctatcgacagtt
cccccaacagcacctccagcaccatctatgcatttagatcttccttatgcggttgcttta
agagatctattctccgagtatcgcatgcgcgcacaaatgaacacaaagtatatggagtct
tctacaagagaagcgactgtaacccatgtattgaatcttatgatttccagattgaccagt
gcggatatccaatcaaccattacaccggatgaaggtagaaatgtaccttggcacatttac
aatatggaagcctgcgacactgcaaaacaagcacttgtaggcatggacagcttaatggaa
atgatcgagctgaaaaaagaaggatatttacctgaaaaagtacgggaattaaaagaaaga
gctgtactattcatggaagaaatcattgaagctggtggatatttcaaagctgttgaacaa
ggcttctttgttgattcaggccactatccggaaagaaacggggatggcattgccagaaaa
attgatggcggaattggggtaggagcaatttatgaaagagatacagattaccttgcacca
gtaaccgcacactttggttataataatgtaaaacaatatgatgaaacggcagaagaccag
ccttcaaaattgatcaacggatctaccctcgaggcacctgaaaagattatttatatcgat
gaattggacgatacagataatgtaaatgtaagaatggaagaaacaaaggaactgcgtgag
tcctcaaaaatccttccagaagttgaatggatgggggatggaattgtacagcttgattta
ttccttccagccagcaaacgtgtagcagaatttgcagcactagaaatgggcaagaaaatg
gggcttgaggatgtagaagtgattcataaagaaatcatgcatccatcagagggaacaaga
atccagcttaagggaagagtagcctttgcaatagacacaaaagatctagtgattcctccg
gagcctgaaattatgtctgaacaggaagttcgagaagcaattgaagcgcagcctatgaaa
attgtagcaggtactgtaggagaagatgagcactctgttggactaagagaaatcattgat
attaagcatggcggtatcgaaaaatatggtattgagtgtcattatcttggaacatccgtt
acacttgagaaactagtagatgctgcaattgaattaaatgcagatgcaattttggcatcc
accattattagccatgatgacattcactatagaaacatgaaacgtattcatgaactatgt
attgagaaaggtgttcgtgataaaattatgatcctctgcggtggtactcaggtaacccct
gagttggctgtaaaacagggaattgatgcaggatttggaagaggaacaaaaggaattcat
gtagccactttcttagtgaagagaagaagtgaaatgaaagatgaaaattaa

DBGET integrated database retrieval system