KEGG   Gramella flava: GRFL_0925Help
Entry
GRFL_0925         CDS       T04640                                 

Definition
(GenBank) Glycosyl hydrolase, family 30
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
gfl  Gramella flava
Pathway
gfl00511  Other glycan degradation
gfl00600  Sphingolipid metabolism
gfl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    GRFL_0925
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GRFL_0925
Enzymes [BR:gfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     GRFL_0925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: APU67649
UniProt: A0A1L7I212
Position
complement(1087559..1089058)
Genome map
AA seq 499 aa AA seqDB search
MKKQKTIKYHLVLICFLAIPFLHFAQQKRVIHSWITTQDRSMLFQAQDSIIPFSKSTNPR
YPAIIVDPVHRMQEVDGFGFALTGGSAELLIGMNPEKRKVILQELFGMHNDDIGISFIRL
SIGSSDLNSYTFSYDDLENRETDTELKSFNLGQDLQDVVPVMKEILAINPDIKIMGSPWS
APVWMKTNQNIRGGKLKETYYEVYADYFVKYILEMEKQGIPIHSITIQNEPMNSRNTPSM
SWYWYEQAGFIKNYLGPKFQEYQLDTKIIIFDHNTDRPDYPLSILQDSLASKYVYGSAFH
NYRGNMETMSMVHRARPDKHIFFTEQMVTEKPNNSTIGITDPFNRLIIQGMNNWSRNVIL
WNLAADPNNDPHTDNGGCSMCQGALTIAGNTVSRNLAYYTIAHASKFVRPGSTRIHTTQP
TDPSVYLYEDEQRAKVNRVWESQSSPLLPNVAFETPKNNIVLIVSNTSSDQHSVKIQYKG
EYANVPLEPGSVGTFVWNQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaaaaactataaagtaccatttggtacttatttgcttcttagctattcct
ttcttgcactttgctcagcaaaaacgagtaatccattcttggattactacccaagatcga
agcatgctttttcaagcgcaagattctattattccattctccaagtcaacgaatccaagg
tatccggcaataatcgtggatccagtccatcgtatgcaagaggtggatggatttgggttt
gcccttaccggaggtagcgcagaattgctgataggtatgaatccggagaaacgaaaagtc
atcctgcaagaattatttggaatgcataatgatgatattggcatcagctttatcaggcta
agcattggctcttctgacctaaatagttacactttctcctatgatgatctggagaaccgt
gaaaccgatacggagttaaaaagctttaatctggggcaggatcttcaggatgtggtaccc
gtcatgaaagaaattttagcgattaatccagatataaaaatcatgggatcaccctggtca
gctccagtatggatgaaaaccaatcaaaatattcgcggtggaaagcttaaagaaacctat
tatgaagtgtatgctgattattttgtgaagtatatcttagaaatggaaaagcagggtatt
cctatacactcgattaccatccagaatgagccgatgaattcgcgtaatactccgagcatg
tcttggtactggtatgagcaggcgggttttataaaaaattatctgggccccaaatttcaa
gagtatcagctcgatacgaagattattatttttgatcataataccgatcgaccagattac
cccttaagtatattgcaggatagtttggccagtaaatatgtctatggttctgcattccac
aattatcgcggcaacatggaaaccatgtctatggtacaccgggcacgtcccgataaacat
attttctttactgaacaaatggtgactgaaaaacctaataatagtactataggaattaca
gatccctttaatcgcctcattattcaaggaatgaacaactggagccgaaatgtcatatta
tggaatcttgcagcagatcctaataacgatccgcataccgataacggcggttgctccatg
tgccaaggtgccctcaccattgcagggaatacagtttcccgcaatctggcttactacaca
attgcgcatgcgtccaaatttgtaagacccgggtccacccgtattcatacgactcaacct
accgatccaagtgtgtatttatatgaagatgaacaaagagctaaggttaacagagtatgg
gaaagtcagagcagccctctattgcctaatgtggcttttgaaacaccgaagaacaatatc
gtgctgattgtttcaaatactagttccgatcaacactcggtgaagattcaatacaaggga
gaatatgcaaacgtacctcttgaaccaggatctgtcggtacatttgtatggaaccaataa

DBGET integrated database retrieval system