KEGG   Gramella flava: GRFL_2213Help
Entry
GRFL_2213         CDS       T04640                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
gfl  Gramella flava
Brite
KEGG Orthology (KO) [BR:gfl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    GRFL_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LTD Glyco_hydro_4
Motif
Other DBs
NCBI-ProteinID: APU68937
UniProt: A0A1L7I5Q5
Position
complement(2511525..2511911)
Genome map
AA seq 128 aa AA seqDB search
MVQQITQGIKISVETHFEGMFYKNYKLRYAFGYRVHIENQSNDTVQLQTRFWEIKDALND
TEFVQGEGVIGKKPVLQPGEHHTYQSGCLLTGPFGAMKGHYNMVNLNTTKKFQVSIPSFK
LAATYALN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacaaattactcagggaataaaaatttcggttgaaacgcattttgaagggatg
ttctacaaaaactacaaattgcgttatgcatttggctaccgggttcacatcgaaaaccag
agcaatgatacggtgcagctccaaacgcgcttctgggaaataaaagatgcgctgaacgat
accgaatttgttcagggcgaaggggtgattggaaaaaaacccgttttacagcccggcgag
caccatacttatcaaagcggctgcttactaaccggtccattcggcgccatgaaaggtcat
tataatatggtcaatctgaatactaccaaaaaattccaggtttcaataccctccttcaaa
ctggctgcaacttacgctttaaactga

DBGET integrated database retrieval system