KEGG   Gramella forsetii: GFO_0397Help
Entry
GFO_0397          CDS       T00448                                 

Definition
(GenBank) protein containing DUF525
  KO
K06195  ApaG protein
Organism
gfo  Gramella forsetii
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    GFO_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: CAL65382
UniProt: A0LYD7
Position
complement(476554..476964)
Genome map
AA seq 136 aa AA seqDB search
MYLFQFFKMVQQVTKGIKISVETQFEGMFYKNYRSQFAFGYRITIENQSNDSVQLQSRFW
QIKDALNNTQTVSGEGVVGKQPFLEPGERHTYKSGCLLTGSFGAMSGHYNMLNLSTSNNF
KVKIPSFKLSAPYTLN
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
ttgtatctttttcaattttttaagatggttcagcaggttacaaaaggcataaaaatttca
gtcgaaactcaattcgaaggtatgttctataaaaattatagaagtcagtttgcctttgga
tataggatcaccatagagaaccaaagcaatgattcggtacaattacaatcaagattctgg
caaataaaagatgctttgaacaatactcagactgtttctggagaaggagtcgttggcaaa
caaccatttttagaaccgggagagcgacatacttataagagtggttgcttgctcactggc
tccttcggggctatgagcggccactacaatatgctgaatttaagcacctccaataacttt
aaggtaaagatcccttcgtttaagttaagcgctccttatacattgaactga

DBGET integrated database retrieval system