KEGG   Gramella forsetii: GFO_1496Help
Entry
GFO_1496          CDS       T00448                                 

Gene name
pcbD
Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
gfo  Gramella forsetii
Pathway
gfo00790  Folate biosynthesis
gfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GFO_1496 (pcbD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gfo04147]
    GFO_1496 (pcbD)
Enzymes [BR:gfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     GFO_1496 (pcbD)
Exosome [BR:gfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GFO_1496 (pcbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: CAL66469
UniProt: A0M1H4
Position
complement(1546904..1547197)
Genome map
AA seq 97 aa AA seqDB search
MMNKLSEEEIQDKLKKFDGWTYAKKSIHTSFQFENFKEAFTVMTRIAFEAEAQQHHPNWG
NVFNELEISLSTHDADGVTEKDFKLARAIEDIVESTN
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaataaattaagtgaggaagagattcaggataaactaaaaaagtttgatggttgg
acgtatgccaaaaaatcaattcatacttcatttcaatttgagaacttcaaagaagcattt
acagtaatgacacgcattgcttttgaagcggaagcacaacaacatcacccaaattgggga
aatgtctttaacgagctggagatctcactttccactcatgatgccgatggtgttactgaa
aaagattttaaattggcaagagccattgaagatatagttgagtctacgaattaa

DBGET integrated database retrieval system