KEGG   Gramella forsetii: GFO_1643Help
Entry
GFO_1643          CDS       T00448                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gfo  Gramella forsetii
Pathway
gfo00010  Glycolysis / Gluconeogenesis
gfo00030  Pentose phosphate pathway
gfo00051  Fructose and mannose metabolism
gfo00052  Galactose metabolism
gfo00680  Methane metabolism
gfo01100  Metabolic pathways
gfo01110  Biosynthesis of secondary metabolites
gfo01120  Microbial metabolism in diverse environments
gfo01130  Biosynthesis of antibiotics
gfo01200  Carbon metabolism
gfo01230  Biosynthesis of amino acids
gfo03018  RNA degradation
Module
gfo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GFO_1643 (pfkA)
   00030 Pentose phosphate pathway
    GFO_1643 (pfkA)
   00051 Fructose and mannose metabolism
    GFO_1643 (pfkA)
   00052 Galactose metabolism
    GFO_1643 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    GFO_1643 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GFO_1643 (pfkA)
Enzymes [BR:gfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GFO_1643 (pfkA)
Protein phosphatases and associated proteins [BR:gfo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GFO_1643 (pfkA)
Messenger RNA biogenesis [BR:gfo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GFO_1643 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: CAL66616
UniProt: A0M1X1
Position
complement(1696703..1697689)
Genome map
AA seq 328 aa AA seqDB search
MSKKVKRIGVMTSGGDSPGMNAAIRAVVRTCAYYHTDCVGYYRGFQGMINGESTNMNARS
VRNLVNQGGTILQSARSKEFLTEEGRAKAAKNLKEAEVDAMILIGGDGTFRGGQIFSQEH
GIPVIGVPGTIDNDIYGTHYTIGYDTALNTVVEAIDKIRDTASSHNRLFFVEVMGRDAGF
IALNSGIGAGAEEILIPEEDLGLERLLDSLERSRRAGKTSSIVVVSEGDKIGKNVFQLAE
YVKKNLPFYDARVTVLGHIQRGGRPSCFDRVLASRLSVKAVELLLDGKRDLMVGMLNNEI
ESCSLDQALKGKHNINKDLLRISEILST
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaagtaaaacgcattggagtaatgacttcaggaggcgattcacccgggatg
aatgcagcgataagagcagttgtgcgaacatgtgcctattatcatacagattgtgttggg
tattatagaggttttcaggggatgattaatggggaatccacaaatatgaacgcgcggagt
gtccgcaacctggtaaaccagggtggaactattttgcagtctgcccgttcaaaagagttt
cttaccgaagaaggcagagccaaagctgcaaagaatttaaaagaagctgaagttgatgcg
atgatcttaattggcggtgatggtacttttcgtggcggtcagatttttagccaggaacat
ggaatcccggtaattggagttcccggaactatcgataatgatatctatggaactcattat
actataggctatgatacggctctcaacaccgtagtggaggccatagataagatacgtgat
actgcaagttctcacaataggttgttctttgtagaagttatgggtcgtgatgccggtttt
attgcccttaatagcggaattggtgccggagctgaagaaattcttattcctgaggaagat
cttgggttagaacgattgttagattctttggaaagaagtagaagagcagggaaaacgtca
agtatcgttgttgtttcagaaggagataagattggtaagaatgtatttcagcttgctgaa
tatgtaaagaaaaatcttccgttctacgatgctcgtgtgacagttttaggacatattcaa
agaggaggaaggcctagttgttttgatcgtgtactggcaagcaggctttctgtaaaagct
gtggagttgttattagatggcaaaagagatctaatggtgggaatgctcaataatgaaata
gagtcctgcagtttagaccaggcactaaaaggaaaacataatattaataaagacctttta
agaatatctgaaatcttatctacttaa

DBGET integrated database retrieval system