KEGG   Gramella forsetii: GFO_1680Help
Entry
GFO_1680          CDS       T00448                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gfo  Gramella forsetii
Pathway
gfo00010  Glycolysis / Gluconeogenesis
gfo00020  Citrate cycle (TCA cycle)
gfo00620  Pyruvate metabolism
gfo01100  Metabolic pathways
gfo01110  Biosynthesis of secondary metabolites
gfo01120  Microbial metabolism in diverse environments
gfo01130  Biosynthesis of antibiotics
gfo01200  Carbon metabolism
Module
gfo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GFO_1680 (aceF)
   00020 Citrate cycle (TCA cycle)
    GFO_1680 (aceF)
   00620 Pyruvate metabolism
    GFO_1680 (aceF)
Enzymes [BR:gfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GFO_1680 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 MIP-T3 RnfC_N NQRA HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: CAL66651
UniProt: A0M206
Position
complement(1735607..1737130)
Genome map
AA seq 507 aa AA seqDB search
MAKEIKIPQIAEGVESATVTEVLVKEGDSIEKDQSIIAVESDKASVEIPSPQAGTVKSIS
VSEGDEVEVGDVILELEEGDAEEDPEEDKEEESEKDNESEKDEDSEKEDSEKENSEEEEK
EDKSKKDKKSTSEEEDSGSSEEKEKASENKEEDAADEDGEDSETKKNKKDQDNDSEDKKD
SKGKKSKKDQEDDSEDSEKDDSKDSEKEKTSRTEDVAAAPGVRRFARELGVDISEVKGSG
EAGRISKEDVKAHNKGSNSQQGKTSNDLSLPDFSKWGETERKAISGIRKATAKNTSAAWS
TIPHVFQFDEADISDIEERMEKLQEKADGNLTITAILAKISASALRQFPKFNASIDMENE
EMILKKYVNIGIAVDTEKGLLVPVVRNADQKTIIEISTEITELAEKARNVKLSAEEMKGG
NFTISNLGGIGGTNFTPIVYHPQVAILGVSRAKKQPVYKDDDTFEARDILPLSLSYDHRI
IDGAEGVRFLHWISRALEDPYEALLGA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaataaagatcccacagatcgcagaaggagtagaatcggctaccgtgacc
gaagtgctggttaaagaaggagacagcatagaaaaagaccagtcgatcatcgcggttgaa
tcagataaagcttcagtggaaattcccagtccgcaggcgggaactgtaaaatccatttcg
gtaagtgaaggggatgaagtagaagtgggtgacgtgatcctggagttggaagaaggggac
gctgaggaggatcctgaagaagataaagaggaagagagcgagaaagataacgagtctgaa
aaggatgaggattcagaaaaagaggattcagaaaaagagaattctgaggaagaagaaaaa
gaggataagagtaaaaaagataaaaaaagcacatcagaagaagaggattcaggcagttct
gaagaaaaagaaaaagcttctgaaaataaggaagaagatgctgctgatgaagatggcgag
gattctgaaacaaaaaagaataaaaaagatcaggataacgactctgaagataagaaggat
tccaaaggaaaaaagagtaaaaaagatcaggaagatgattccgaagattctgaaaaagat
gattccaaagattctgaaaaagaaaaaacttcgagaacggaagatgtagcggcggcgccg
ggggttcggagatttgcccgggaacttggtgttgatattagtgaagtaaaaggcagcggc
gaagctggtagaatcagcaaagaagatgtgaaggctcataataagggaagtaatagccag
caaggaaaaacttccaatgatctatcgcttccggatttcagcaaatggggagaaaccgaa
cgaaaagcaatttcggggatcaggaaagcgacggcaaagaatacttcggcggcgtggagc
actattccgcatgtatttcagtttgacgaagccgatatttcagacattgaagagcgtatg
gagaaacttcaggaaaaagctgatggaaatcttaccattactgctattctcgctaagata
tcggccagcgctttaagacagttccctaaattcaacgccagtatcgacatggaaaacgag
gaaatgatccttaagaaatatgtgaatatcgggatcgcggtagatactgaaaaaggcctg
ctggtgcctgtagttagaaatgcagatcaaaaaacaattatcgagatctctactgaaatc
actgaattagcggagaaagcccggaacgtgaaactcagcgccgaagaaatgaagggtgga
aacttcaccatttccaatcttgggggaattggtggtactaatttcactcctattgtttat
catccgcaggtagctattctcggggtctccagggcgaagaaacaaccggtgtataaagat
gatgatacttttgaagcacgggatattctcccgttgagcctttcttacgatcatagaatt
attgatggtgcagaaggtgtgcgattcctgcattggatttcccgtgcgcttgaagatcct
tacgaagctttattgggagcttaa

DBGET integrated database retrieval system