KEGG   Gramella forsetii: GFO_1968Help
Entry
GFO_1968          CDS       T00448                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gfo  Gramella forsetii
Pathway
gfo00260  Glycine, serine and threonine metabolism
gfo00750  Vitamin B6 metabolism
gfo01100  Metabolic pathways
gfo01110  Biosynthesis of secondary metabolites
gfo01120  Microbial metabolism in diverse environments
gfo01230  Biosynthesis of amino acids
Module
gfo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GFO_1968 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GFO_1968 (thrC)
Enzymes [BR:gfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GFO_1968 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CAL66933
UniProt: A0M2T8
Position
complement(2078156..2079451)
Genome map
AA seq 431 aa AA seqDB search
MNYFSLNNREHTSNFENAVVRGLAPDKGLYFPDKIKKLPASFFQNIGNLDRTEISFEAIK
AYVGDEIPDSALIDIINETVDFEFPIVDVKKNIGSLELFHGPTLAFKDVGARFMAGSLGY
FIKKGNLGKITVLVATSGDTGGAVANGFLGIEGIDVVILYPKAKVSEIQEKQLTTLGQNI
TALEVDGNFDDCQAMVKKAFLDSEITDHRKLTSANSINVARWLPQMFYYFFAYKQLKEID
KKLVFSVPSGNFGNICAGLLAREMGLPIDHFVASNNANDTVTNYLETEEYNPKPSVQTIS
NAMDVGDPSNFVRVLKLFKDKHANLKEHFSAYSFDDEKTKQAIKEVYSETKYVMDPHGAV
GYLGLKKFLESNPEYHGTFLETAHPVKFLETVEAAIKKKVEIPDSIKGLMDKQKKSLQIS
NYDELKNYLLQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaactatttcagcttaaataacagggagcataccagtaattttgaaaatgccgtggtt
cgcggattggctccggacaagggactttatttcccggataagattaaaaaacttcctgcc
tctttttttcaaaatattggaaatctggatagaactgagatttcctttgaagcaattaaa
gcatacgtaggtgatgaaattccagattcagcgttaatagatattattaacgaaacggta
gattttgaatttccgattgttgatgtaaaaaagaatattggaagcctggaactttttcat
ggacctacccttgcatttaaagacgtaggagccaggtttatggcgggtagtttagggtat
tttatcaaaaaagggaacctgggaaaaatcactgttttggtggctacttcaggagatacc
ggtggagcagtagctaacggatttcttggtattgaaggaatagatgtggtcatactgtac
ccaaaagctaaggtgagtgaaattcaggaaaaacagcttacaactttaggtcaaaatatt
acggctctggaagttgatggtaattttgatgattgccaggcgatggtaaaaaaagctttt
cttgattctgaaattacagatcatagaaaacttacctcggcgaattctattaatgtggcg
agatggctaccgcaaatgttctattacttttttgcttataaacagttgaaggaaatagac
aaaaaattagtgttttcggttccaagcgggaatttcggtaatatctgtgctggcttgcta
gctcgggagatgggattacccatagatcattttgtcgcttcaaacaacgccaatgatacc
gttaccaattatctggaaactgaagagtataatccgaaacctagtgtgcaaactatctcc
aatgctatggatgtaggagatcctagtaactttgttagagttcttaaattatttaaggac
aaacatgctaatctaaaagaacatttttcggcatatagttttgatgatgagaaaacgaaa
caagctattaaagaggtgtattcagaaacaaagtatgtgatggatcctcatggtgcggtt
ggttatcttggattgaaaaaattcctggaaagtaatcctgaatatcacggtactttcctt
gagactgcacatccggtgaagtttttagaaactgtagaagctgccattaagaaaaaggta
gagattccagattctattaaaggcttaatggataaacaaaaaaaatcccttcaaatcagc
aattatgatgagctgaaaaattatcttctacaatag

DBGET integrated database retrieval system