KEGG   Gramella forsetii: GFO_2697Help
Entry
GFO_2697          CDS       T00448                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
gfo  Gramella forsetii
Pathway
gfo00564  Glycerophospholipid metabolism
gfo01100  Metabolic pathways
gfo01110  Biosynthesis of secondary metabolites
Module
gfo_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GFO_2697 (psd)
Enzymes [BR:gfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     GFO_2697 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CAL67653
UniProt: A0M4V8
Position
2814369..2815025
Genome map
AA seq 218 aa AA seqDB search
MFHKEGYKIMTITAIILIAINIISYSLINVYWIKFAVLLTSILFFFLIIQFFRNPKRTTS
LNNEHIIAPVDGKVVVIEEVYEKEYFKDKRLQISIFMSPINVHVTRHPVGGKVTFSKYHP
GKFLVAWHPKSSEENERTTVVVKNEAIGEILYRQIAGAMAKRIVNYAEVDTEVVQGSDSG
FIKFGSRVDVFVPIGTKVNVEINQKVKGGISIIADVAS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttcataaagaaggatataaaataatgaccattactgcgatcatcctgattgcaata
aatatcatttcatacagtttaattaatgtatactggataaagtttgcagttctgcttaca
tctattctttttttctttctgattattcagtttttcagaaatccaaaaagaaccacaagc
ttaaacaatgagcacattattgccccggtagacggaaaggttgtggtaattgaggaggtt
tatgagaaagaatactttaaagataagagactgcaaatttcaattttcatgtcgcctatc
aatgtacatgttacgcgacatccagtaggtggaaaagttacttttagcaaataccatcct
ggaaaatttctggttgcctggcatccaaagtccagtgaagaaaatgagagaactaccgtg
gttgtaaaaaatgaggctataggagaaatactatatcgtcaaattgcaggagcaatggca
aaaagaatagtgaattacgctgaagtggatactgaagtagttcagggaagcgatagcgga
tttattaaatttggtagcagggttgatgtatttgttcctattggaacaaaagtgaatgtt
gaaatcaatcaaaaagtaaaaggaggcattagtataattgctgatgtggcttcttaa

DBGET integrated database retrieval system