KEGG   Gramella forsetii: GFO_2720Help
Entry
GFO_2720          CDS       T00448                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
gfo  Gramella forsetii
Pathway
gfo00380  Tryptophan metabolism
gfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    GFO_2720
Enzymes [BR:gfo01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     GFO_2720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CAL67676
UniProt: A0M4Y1
Position
complement(2835732..2837009)
Genome map
AA seq 425 aa AA seqDB search
MQFENTREFAKKLDNEDKISKYRDEFIFPKVNGKDVIYFVGNSLGLQPKTARKYVDEVMK
DWAELAVEGHFYAEKSWWDYHERFSEKLARVVGANPSEVTVMNTLTVNLHLLMVSFYRPS
GKRYKIICEEKAFPSDQYMISSQVRFHGYEPSDAIVEIMKREGENNFRTEDILKKIEEVG
EECALVLIGGVNYYTGQVFDMETITKAGHDIGAFVGWDLAHGAGNIELKLSEWNVDFAAW
CSYKYMNSGPGNASGCFINKKYHNKKDIPRFEGWWGHNKERRFLMEPEFQPEPTADAWQI
SNAPILALAPYLASLEMFDEVGMPALIEKRNKIVAYLEFVLHEIDEEVDSSFEIITPADQ
NERGTQLSVFLHGEGKELFRYLMDQGVITDWREPNVIRLAPAPFYCSFEDMYEFGQILKK
GILSK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgaaaataccagggaatttgccaaaaagctcgacaatgaagataagatctca
aaatatagggatgagtttatctttccgaaagtaaatggcaaagatgtaatttactttgtt
gggaattcactgggacttcaacctaaaacagcccgaaaatacgtagatgaggtgatgaaa
gattgggctgaacttgccgtagagggacatttttatgctgaaaaatcctggtgggactat
catgaaagattttcagaaaaattagccagggtagtaggtgcgaatccttctgaagttacc
gtaatgaacacacttaccgttaatcttcatttattgatggtttctttctatagaccttca
ggtaaacgttataaaattatttgtgaggaaaaagctttcccaagtgatcaatatatgatt
tccagtcaggtacgttttcatggttacgaaccttcagatgctattgttgaaattatgaag
cgagagggggagaacaactttagaactgaagatatactcaaaaagatagaggaagtagga
gaggagtgtgccctggtcttaataggaggtgtaaattattatacgggacaggtttttgat
atggaaacgattacaaaagctggacacgatataggagcttttgtaggttgggatcttgca
cacggagcaggaaatattgaattaaagttaagtgagtggaatgtagatttcgctgcctgg
tgtagctacaagtacatgaattcgggccctggaaatgcatccggttgttttataaataag
aaatatcataataagaaggatataccaaggtttgaaggttggtggggtcataataaagaa
agaagatttttaatggaaccggaatttcaaccggaaccaacagcagatgcctggcaaata
agcaatgctcctattctggcattggcaccatatttagcatcattagagatgtttgatgag
gtgggaatgccagcattaatagagaaaagaaataagatcgtagcttatctggaatttgta
ttacatgaaattgatgaggaagtagatagctcttttgaaatcatcactcctgcagatcaa
aatgagcgcggtacgcagctttcagtatttttgcatggagaaggaaaggagcttttcaga
tatttaatggatcagggggtaatcacagattggcgcgagccaaatgtgataaggttagct
cctgcacctttttactgttcttttgaagatatgtatgaatttggacagatccttaaaaaa
gggattttaagtaagtaa

DBGET integrated database retrieval system