KEGG   Gramella forsetii: GFO_2817
Entry
GFO_2817          CDS       T00448                                 

Gene name
rpsM
Definition
(GenBank) 30S ribosomal protein S13
  KO
K02952  small subunit ribosomal protein S13
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2817 (rpsM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2817 (rpsM)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    GFO_2817 (rpsM)
  Archaea
    GFO_2817 (rpsM)
SSDB
Motif
Pfam: Ribosomal_S13 FbpA
Other DBs
NCBI-ProteinID: CAL67771
UniProt: A0M576
Position
complement(2932794..2933168)
AA seq 124 aa
MARIAGVDIPKQKRGVIALTYIFGIGRSRAQEILAQAKVDESKKVSDWDDDEIGKIREAV
GQFTIEGELRTEVQISIKRLMDIGCYRGIRHRAGLPLRGQRTKNNSRTRKGRRKTVANKK
KATK
NT seq 375 nt   +upstreamnt  +downstreamnt
atggcaagaattgcaggggtagatatacctaaacaaaagcgaggggttatagcattgacc
tatatcttcggaattggcagaagcagggctcaggagatacttgcacaagctaaagtagac
gagagtaagaaagtctcagattgggacgatgacgagattggtaaaatccgtgaggctgtt
ggtcagtttacaattgaaggagaattacgtactgaagttcaaattagtatcaaacgtctt
atggacattggatgctatagaggaattcgtcacagagctggacttccattaagaggtcaa
agaactaagaacaactccagaaccagaaaaggaagaagaaaaacagttgctaacaagaaa
aaagcgactaaatag

DBGET integrated database retrieval system