KEGG   Geospiza fortis (medium ground-finch): 102031435
Entry
102031435         CDS       T03755                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
gfr  Geospiza fortis (medium ground-finch)
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gfr03000]
    102031435 (AHRR)
Transcription factors [BR:gfr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102031435 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 102031435
NCBI-ProteinID: XP_005419393
Position
Un
AA seq 757 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIVSK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQVGQTIKEDNISNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQLQSETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVRAKHKADDAAAANTN
SSSKGSSGLCEATELYGRNNHHEGAAFTNALQIAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANTQLLYRSGCSEYVLAQQQMLKEEDEQLKILSGFASLKGNLEGLSYNSAIETLGQ
WKHLNWAAVKNEQDNVKVKFEPHTNGECFMQEEPLSSNTSVLGIQNNCTTNSSWTLRNSS
SCSMNQRMNTCPNRRTGSFYNRDQNFLNLASTCPSHWGNAENGQSYSGLPQRCAESYATD
HGKLQRPFTSSESLYETATPLEMPIKTEYDSDSENIADNYLQSRAWLDESGSLRKQGPSY
PSRVHLKTEPDLCQPALPCQKPRHCLYTPHNWQCIVANHPNNLNLNRAGKGSRNKEVPPF
CPQNSSVCLESMPDLAHTACYGHFYSPSPGEEKEQINEVFKMPCEFKNPCLVQAIKREPL
DSPPLSSSGQNRVHASFPENTLAGPVPHKTTECTFLQ
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctgtatgctgggaggaaaaggaggaaacccattcaaaaa
caaaggcctgcagttgggaatgaaaaatcaaatccttcgaagagacacagagaccgtctg
aatgcggaactggaccacctggccagccttcttccttttccccctgacatcgtatcaaag
ctggacaaactttccgtcctgcgcctcagtgtcagctatctgcgagtcaagagtttcttt
caagccattcaagaaaagcactttaagaagcaagttggccaaacgataaaagaagacaat
atctctaacaagactgctgtacaagaaggtggacttctactagaatcactgaatggtttt
gccttggtggtgagtgcagatggaatgatattctatgcatcatcaacaattgtggactat
ctagggtttcatcagactgatgtaatgcaccaaaacatctacgattacatccacgtggat
gaccgccaggatttctgcagacaactgcactgggccatgaatcctccccagatgttgtcg
ggacagcaactacagtcagaaacaggggaagaatatattctcagtaaattgttcaaagca
caagagaatgacagcatgacaacagattattcttcctttttaactcgctgtttcatctgt
cgagttcgctgcttgttggacagtacttctggattccttacaatgcagttccaaggcaaa
ctaaagttcctctttggacaaaggaagaagtcctcatcaggaacagtattgccacctcag
ctgtccttattctgcatagtggtaccacttctgctcccttctgtgacagagatgaagatg
aaaagcctgcttgtgagagcaaaacacaaagctgacgatgcagcagcagcgaacacaaac
tccagttcaaaaggcagttcaggactttgtgaagcaacagaattatatggaagaaacaat
caccatgaaggtgctgccttcactaatgcattacagattgctgaaaaccaaatcaaagca
aagaataatggagaaaatggcatttctctagtcaaagtacaaacaaatgaagatcactgg
gtctgggttcaagctaacactcaacttctgtatcgaagtggttgttcagaatatgttctt
gcccaacagcaaatgttaaaggaagaagatgaacaactgaagatactaagtggttttgcc
agtttgaaaggaaacttggaggggctttcctataacagtgccattgaaactctgggccaa
tggaagcatcttaactgggcagcagtgaagaatgaacaagataatgtaaaagtgaagttt
gagcctcatactaacggtgagtgttttatgcaagaagaacctctcagttctaacacatca
gttttaggcattcaaaacaactgcaccacaaacagtagctggactttaagaaactccagt
tcttgttctatgaaccagagaatgaacacctgtccaaaccggagaactggatcattctac
aacagagaccaaaatttcttaaatctggcatcaacttgtccttcccactgggggaatgca
gaaaatggccagtcctactcggggctcccacagcgctgtgcagagagctatgccacagac
catgggaaactacagagaccattcacatcctcagagtctctctatgaaacagccactccc
ttggagatgcctatcaaaacggaatacgactctgactctgaaaacattgctgataactac
ctgcagagccgagcctggctggatgagagcggctcgctgaggaagcaggggcccagctat
cccagcagagtgcacctcaaaacagagccagacctctgccagccagccttgccttgtcag
aagccaaggcactgcctttacacaccccataactggcaatgcatcgtagcaaatcatccc
aacaacctgaacttgaacagagctggcaagggctcacggaacaaggaggtgccccccttt
tgccctcagaactcctctgtgtgtttggaaagcatgcccgacctggcacacacagcttgc
tatggccacttctacagtcccagcccaggggaggagaaagagcagattaatgaggtgttc
aaaatgccatgtgaatttaaaaacccctgcttggttcaagcgatcaagcgtgagcccctg
gattctccaccgttgtccagcagtggacagaacagagtacacgcaagcttccctgaaaat
accttagcaggtcctgtgcctcataaaaccactgaatgtacatttttgcaatag

DBGET integrated database retrieval system