KEGG   Geospiza fortis (medium ground-finch): 102031798Help
Entry
102031798         CDS       T03755                                 

Gene name
FBP2
Definition
(RefSeq) fructose-1,6-bisphosphatase isozyme 2
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00010  Glycolysis / Gluconeogenesis
gfr00030  Pentose phosphate pathway
gfr00051  Fructose and mannose metabolism
gfr01100  Metabolic pathways
gfr01200  Carbon metabolism
gfr04910  Insulin signaling pathway
Module
gfr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102031798 (FBP2)
   00030 Pentose phosphate pathway
    102031798 (FBP2)
   00051 Fructose and mannose metabolism
    102031798 (FBP2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102031798 (FBP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gfr04147]
    102031798 (FBP2)
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     102031798 (FBP2)
Exosome [BR:gfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102031798 (FBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 102031798
NCBI-ProteinID: XP_005426942
Position
Un
AA seq 340 aa AA seqDB search
MTDKSPFETDMLTLTRFVMEKGRRVKGATGELTQLLNSMLTAIKAISAAVRKAGLAHMFG
IAGTVNVTGDEVKKLDVLSNSLVINMLQSSYSTCVLVTEENKEAIITPKDKRGKYVVCFD
PLDGSSNIDCLAPIGTIFAIYKKETDDEPSEKDALQPGRNIVAAGYALYGSATLVALSTG
QGVDCFMLDPGLGEFILVDRDVKIKKKGKVYSLNEGYAKYFDPAMTEYLQKKKFPEDGSS
PYGARYVGSMVADVHRTLMYGGIFMYPANQKSPKGKLRLLYECNPMAFIIEQAGGIATTG
TEAVLDVKPENIHQRVPFILGSPDDVQEYLACVQKHQKST
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaaaagccccttcgagacggatatgctgacactcacgcggtttgtcatggag
aagggacgccgcgtgaagggagcgacgggggagctgacgcagctgctcaactccatgctg
actgccataaaggccatttctgctgctgtcagaaaggcaggccttgcccacatgtttggt
atagctggcactgtgaatgtgacgggtgatgaggtgaagaaactggatgtgttatccaac
tccctggtgattaacatgctccagtcctcctacagtacctgtgtcctggtcacagaggag
aacaaggaggccatcatcaccccgaaagacaagcggggtaaatatgtggtgtgctttgac
ccccttgatggttcatccaatatagactgcttggcaccaataggaacaatatttgctatc
tacaaaaaggaaacagatgatgagccctctgaaaaagatgctttacagcctggacgcaat
attgttgctgcaggctatgccctgtatggtagtgctacgctggttgccctctccacaggg
caaggagtggactgcttcatgcttgatccgggccttggtgaatttattttggtggacaga
gatgttaaaatcaagaagaaggggaaggtatacagtctcaatgaaggttatgcaaaatat
tttgatcctgcaatgacagaatatttgcaaaagaagaaattccctgaggatggcagttcc
ccatatggtgccaggtatgtgggctccatggtagctgatgttcaccgtacattgatgtac
ggtgggatcttcatgtatcctgctaatcagaagagtcctaaaggaaagctccgacttctc
tatgaatgcaaccctatggctttcatcatcgagcaggcaggtggcatagcaactacaggg
accgaagcagtgttggacgtgaagcctgagaatattcaccagagagttccttttatcctt
ggctctccagatgatgtgcaagaataccttgcttgtgtacagaaacaccagaagagcaca
taa

DBGET integrated database retrieval system