KEGG   Geospiza fortis (medium ground-finch): 102031853Help
Entry
102031853         CDS       T03755                                 

Gene name
CREM
Definition
(RefSeq) cAMP responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102031853 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gfr03000]
    102031853 (CREM)
Transcription factors [BR:gfr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102031853 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 102031853
NCBI-ProteinID: XP_005428936
Position
Un
AA seq 329 aa AA seqDB search
MTKCAKKYRKGAVRLMTMEMVEQDDNAVDSLTERSAGHLQNQPGQNQISSGSEVSVAASS
AGRGSPAVTLVQLPSGQTVHVQGVIQATQPSVIQSPHMQAVQVASIADEAAQAEVIIDSQ
KRREILSRRPSYRKILNELSSDAPAVAKIEEEEKSEDEGTPSGISAVAMPTSLYHTNTGQ
YLTISQGGTIQTVTNSGAPQPGATIVQYAAQSSDGTQQFFVPGSQVVVQAATGDMPAYQI
RTPTTTLPQGVVMAASPGTLHSPQQMAEEATRKRELRLLKNREAAKECRRRKKEYIKCLE
SRVAVLEVQNKKLIQELETLKDICSSKTD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtgtgccaagaaatatcgaaaaggagctgtcagactgatgaccatggaaatg
gttgaacaggatgacaatgcagtggattctctgacagagagaagtgctggtcaccttcag
aatcagccaggccagaatcagatttcctcaggatctgaggtttctgtagctgcttccagt
gctggaagaggatctccagctgtaactctagtgcagttgccttctggtcaaactgttcat
gtccagggtgtcattcaagccacacagccctcagtcattcagtcaccacacatgcaagct
gttcaggtagcatcgattgcagatgaagctgcacaagcagaagtgataattgattctcaa
aaacgtagggaaatactttcaagaaggccttcataccgaaaaattttgaatgagctctcc
tcagatgcacctgcagtagcgaagattgaagaagaagagaagtcagaagatgaaggaacg
ccttctggtatttctgcagtggccatgccaacgagcctgtatcatactaacacagggcaa
taccttaccatatctcaaggtggtacaattcagactgtgacaaactcaggagctcctcag
ccaggcgctaccattgtgcaatatgcagcacagtcatctgatggcacacaacagtttttt
gttcctggaagccaagttgttgttcaagctgccactggagacatgccagcttaccagatc
cgaactcccactactaccttacctcagggagtggtgatggcagcctcgccagggactctg
cacagccctcagcaaatggcagaggaggccacacgcaagagagagctgagacttttgaaa
aatagggaagctgctaaagaatgtcgacgtcggaagaaagaatacataaaatgtctggag
agtcgtgttgcagtgctagaagttcagaacaagaaacttatacaggagcttgaaacccta
aaagacatttgctcttccaaaacagattag

DBGET integrated database retrieval system