KEGG   Geospiza fortis (medium ground-finch): 102031855Help
Entry
102031855         CDS       T03755                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta chain
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04012  ErbB signaling pathway
gfr04020  Calcium signaling pathway
gfr04114  Oocyte meiosis
gfr04217  Necroptosis
gfr04261  Adrenergic signaling in cardiomyocytes
gfr04310  Wnt signaling pathway
gfr04912  GnRH signaling pathway
gfr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102031855 (CAMK2D)
   04310 Wnt signaling pathway
    102031855 (CAMK2D)
   04020 Calcium signaling pathway
    102031855 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102031855 (CAMK2D)
   04217 Necroptosis
    102031855 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102031855 (CAMK2D)
   04916 Melanogenesis
    102031855 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102031855 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102031855 (CAMK2D)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102031855 (CAMK2D)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   102031855 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2 SnoaL_4
Motif
Other DBs
NCBI-GeneID: 102031855
NCBI-ProteinID: XP_014166092
Position
Un
AA seq 546 aa AA seqDB search
MNAGAVPYHGGAGLAVRGPSRGSLSRAGSDGRDPAHAQCACAPPFPPHAAGAAVTGAFSV
VRRCMKITTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHY
LVFDLVTGGELFEDIVAREYYSEADASYCIQQILEAVLHCHQMGVVHRDLKPENLLLASK
SKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYIL
LVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEAL
KHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDGV
KINNKTNVVTSPKENIPTPALEPQTTVIHNPDGNKESTESSNTTIEDEDVKARKQEIIKV
TEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTI
ILNPHVHLVGEDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSP
TVPINA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccggggccgttccctaccacggcggtgcggggctggctgtgcgcggtccctcc
cgcgggtccctttctcgggcgggcagtgacggtcgcgacccggcgcacgcgcagtgcgcc
tgtgccccccccttcccaccgcacgcggccggagcggccgtgacaggggcgttctccgtc
gtgaggaggtgtatgaaaatcaccacaggacaagagtacgctgccaaaattatcaacacc
aaaaagctttcagctagggatcaccagaaactggagagagaagctagaatctgtcgtctc
ctgaagcatcctaatatcgtgcggctccatgacagcatatcagaagaaggattccattac
ttagtctttgacttagtcactggaggtgaattgtttgaagatatagttgcaagagagtat
tatagtgaagcagatgccagttattgcattcagcagatcctggaggccgtgctgcactgc
catcagatgggcgtggtccatcgcgacctcaagcctgagaacttacttctagctagcaaa
tccaagggagcggcagtcaaactggcagactttggattggctatagaagtccagggagaa
caacaggcttggtttggctttgctggtactccaggatacctttctccagaagtgttacga
aaagatccttatggaaaacctgtggatatgtgggcatgtggagtcattctgtacatcctc
ctggtgggataccctcccttctgggatgaagaccagcacaggctttaccagcagatcaag
gctggtgcttatgatttcccctcaccagaatgggacacagtgactcctgaagcaaaagac
cttatcaataaaatgctcaccatcaatccagcaaaacgtatcacagcatcagaagcacta
aagcatccatggatctgtcaacgttctactgttgcctctatgatgcacagacaagaaact
gtagattgcttgaagaaattcaatgcaagaagaaaactaaagggggccattttgacaaca
atgctggctaccagaaatttctcagcagccaagagtttactgaaaaagccggatggagtt
aagataaacaacaaaaccaacgtggtaaccagccccaaggaaaatattcctaccccggcg
ctggagccccaaactacagtaatccacaaccctgatggaaataaggaatctacagagagt
tccaacacgaccatcgaagatgaggatgtgaaagctcgtaagcaggagattatcaaggtg
accgagcagttgattgaagccatcaacaacggggacttcgaagcttacacaaaaatctgt
gatcctggccttacgtcttttgaacctgaagctttgggtaatctggtagaagggatggac
ttccaccggttttacttcgaaaatgctctgtccaaaagcaacaagccgatccacacgatc
atcctgaacccccacgtgcacctggtgggcgaggacgcggcgtgcatcgcctacatccgc
ctgacgcagtacatggacggcagcggcatgcccaagaccatgcagtccgaggagacacgc
gtgtggcaccggcgcgacggcaagtggcagaacgtgcacttccaccgctcgggctcgccc
accgtgcccatcaatgcctag

DBGET integrated database retrieval system