KEGG   Geospiza fortis (medium ground-finch): 102032250Help
Entry
102032250         CDS       T03755                                 

Gene name
G6PD
Definition
(RefSeq) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00030  Pentose phosphate pathway
gfr00480  Glutathione metabolism
gfr01100  Metabolic pathways
gfr01200  Carbon metabolism
Module
gfr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
gfr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102032250 (G6PD)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102032250 (G6PD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gfr04147]
    102032250 (G6PD)
Enzymes [BR:gfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     102032250 (G6PD)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     102032250 (G6PD)
Exosome [BR:gfr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102032250 (G6PD)
  Exosomal proteins of colorectal cancer cells
   102032250 (G6PD)
  Exosomal proteins of bladder cancer cells
   102032250 (G6PD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 102032250
NCBI-ProteinID: XP_014166880
Position
Un
AA seq 551 aa AA seqDB search
MSPEGDLARKKIYPTIWWLFRDGLLPDDTRVVGFARSPLTVELIHEQTLPYLKVTPEDGP
CLAAFLSLQSFVRGQYGDEASFRALDAHLQGLPGGDRAHRLFYLALPPSVYTPVTQHLRA
LCMGQGWNRVIVEKPFGRDLGSSEELSAHLSALFREEQIYRMDHYLGKEMVQSLMVLRFG
NRIFGPIWNRDNVACVVLTFKEPFGTEGRGGYFDDFGIIRDVMQNHLLQLLCLVAMEKPA
STNPDDVRDEKVKVLKCISPVELQDVVLGQYVGNPEGPPEAQKGYLDDPTVPAGSTTPTF
ATAVLRVANERWDGVPFVLRCGKALNERKAEVRLQFREVPGDIFARQCKRNELVVRVQPR
EAVYAKLNTKKPGMFLRPEESELVIKAGRRTQISTKGPKAHAQRRKVQKFSHEEDHNLQP
QRPPETPMRPPQQTTHAQEGVDPITIAAPGQPQELLLMETPGKGIQGEPQAEAPQLHTVS
HWGLFWKNSLLGTQRALELLDGINYCCTSCSGHVLAKGTASRVTSRTASRVTSGVASRVT
SRVTSRTSSRM
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtccccagagggcgacctggccaggaagaagatttaccccacgatatggtggctgttc
cgggatgggctcctccccgatgacacgcgcgtcgtcggcttcgcccgctcgcccctcacc
gtggagctcatccatgagcagaccctgccctacctcaaggtgacccccgaggacgggccc
tgcctggccgcgttcctgtccctgcagagcttcgtgcggggtcagtacggggacgaggcc
tcgttccgggcactggacgctcacctgcaggggctgcccgggggtgaccgcgcccaccgg
ctcttctacctggcactgccccccagcgtgtacacacctgtgacccagcacctgagagcg
ctctgcatgggccaggggtggaaccgcgtgatcgtggagaagccgtttgggcgggacctg
ggctcgtcggaggagctgtcggcgcacctgagcgcgctgttccgcgaggagcagatctac
cgcatggaccactacctgggcaaggagatggtgcagagcctcatggtgctgcggttcggt
aaccgcatcttcgggcccatctggaaccgcgacaacgtcgcctgcgtggtgctcaccttc
aaggagcccttcggcaccgagggccgcggcggctacttcgacgacttcggcatcatccgg
gacgtgatgcagaaccaccttctgcagctgctctgccttgtggccatggagaagccagca
tccaccaaccccgacgatgtccgtgacgagaaggtgaaggtgctcaagtgcatcagcccg
gtggagctgcaggacgtggtgctgggccagtacgtgggcaaccccgagggcccccccgag
gcacagaagggctacctggacgaccccacggtgcccgccggctccaccacgcccaccttc
gccaccgcggtgctgcgcgtggccaacgagcgctgggacggtgtcccgttcgtgctgcgc
tgcgggaaggcgctgaacgagcgcaaggccgaggtgcggctgcagttccgggaggtgccc
ggggacatcttcgcgcggcagtgcaagcgcaacgagctggtggtgcgggtgcagccgcgc
gaggccgtctacgccaagctcaacaccaagaaacccggcatgttcctgcggcccgaggag
tccgagctcgtaatcaaggccggcagacgtactcagataagcaccaagggaccaaaagcg
cacgcgcaaaggagaaaagttcaaaagttcagtcatgaggaagaccacaatcttcagcct
cagagaccaccagagacccccatgcgaccaccacagcaaacaacgcatgcccaggagggt
gtggatccgattaccatagcagctcccgggcagccgcaggagctgctgctcatggagact
cctggcaaggggatccagggagaaccacaggcagaggcacctcagctccacactgtgtct
cactggggcttgttctggaaaaacagccttctgggaactcagcgtgcactggaactgctg
gacgggattaactactgctgcacgagctgctcaggccatgttctggccaaggggacggcc
agcagggtgaccagcaggacggccagcagggtgaccagcggggtggccagcagggtgacc
agcagggtgaccagcaggacatccagcaggatgtga

DBGET integrated database retrieval system