KEGG   Geospiza fortis (medium ground-finch): 102032646Help
Entry
102032646         CDS       T03755                                 

Gene name
CD38
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00760  Nicotinate and nicotinamide metabolism
gfr01100  Metabolic pathways
gfr04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102032646 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102032646 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gfr04090]
    102032646 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:gfr00536]
    102032646 (CD38)
Enzymes [BR:gfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     102032646 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     102032646 (CD38)
CD molecules [BR:gfr04090]
 Proteins
  102032646 (CD38)
Glycosaminoglycan binding proteins [BR:gfr00536]
 Hyaluronan
  Cell surface receptors
   102032646 (CD38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 102032646
NCBI-ProteinID: XP_005415476
Position
Un
AA seq 308 aa AA seqDB search
MPLPQGSARARQRTVLLVGIAVLLAALVLAVVLASLLTHGRHEVSPQMLKWKDRGTTKNL
QEVILGRCYNYITAQHPELGDKDCLKIWESLKDAFIYKNPCNITPEDYQPLMELASHPIP
CNKSLFWSKTNDLVHRYTKSNQNFLTLEDTLLGYMADRVSWCGDPSAPGINYESCPKRNE
CESNPGSVFWKMASKMFAEAACGVVQVMLNGSVEAGAFRSSSIFGSIEIFNLDPDKVTEV
HIWLMQNIGGPQSESCSGQSIQRLISILEERKFKIICQDNYRPVQLLQCVHNPDHTDCRL
CTNSSAIP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgccgcagggctctgcccgggcccggcagcgcaccgtgctcctggtgggcatc
gccgtgctgctggccgccctcgtcctcgccgtcgtgctggcctctctgctgacccacgga
aggcacgaggtcagtccccaaatgctgaagtggaaggacagggggaccacgaagaacttg
caggaagttattctgggaagatgctacaactacatcacggcgcagcacccggagctggga
gataaggattgtctaaaaatatgggaatcattaaaagatgccttcatatataagaacccc
tgtaatatcacaccagaagattatcagcctttgatggagctggcaagtcaccctataccc
tgcaacaagtcactgttttggagcaagacaaacgaccttgttcatcgttatacaaaatcc
aatcagaatttccttaccctggaggacaccttgctgggttatatggctgacagagtttca
tggtgtggagacccctctgccccaggaatcaactatgaatcttgtccaaaacgaaatgaa
tgtgagagcaaccctggctctgtgttctggaaaatggcatccaagatgtttgcagaagca
gcatgtggtgtggttcaagtgatgctcaatggatcagtagaagctggagctttcaggagc
agcagcatctttggaagtattgagatctttaacctggatccagataaagtcactgaagtg
cacatttggctcatgcagaacattggtggccctcaaagtgaatcctgctcaggtcagtcc
attcagaggttaataagcattttagaagaacgaaagtttaagatcatctgtcaagacaat
tacaggcctgttcagctccttcagtgtgtgcataacccagaccacacagactgcaggctt
tgcaccaacagctcagcaattccatga

DBGET integrated database retrieval system