KEGG   Geospiza fortis (medium ground-finch): 102033388Help
Entry
102033388         CDS       T03755                                 

Gene name
NELFA
Definition
(RefSeq) negative elongation factor complex member A
  KO
K15179  negative elongation factor A
Organism
gfr  Geospiza fortis (medium ground-finch)
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gfr03021]
    102033388 (NELFA)
Transcription machinery [BR:gfr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    NELF complex
     102033388 (NELFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 102033388
NCBI-ProteinID: XP_005424767
Position
Un
AA seq 539 aa AA seqDB search
MPVENPLFFRPAPKMASMRESDTGLWLHNKLGSTDELWAPPSIASLLTASVIDNIRLCFH
GLSSAVKLKLLLGMLHLPRRAVDEMKGALTEIIQLATLDSDPWVLMVADILKSFPDTGSL
NLDLEEQNPNVQDILGELREKVSECETSAMLPLECQYLNKNALTTLAGPLTPPVKHFQLK
RKPKSATLRAELLQKSTETAQQLKKTAGVPFHAKGRGLVKKIDTTTPLKGIPKQAPFRST
SAPSVFSPSGNRTPIPPSRTPLRKERGVKLLDISELDMVGAGREAKRRRKTLDAEVVEKQ
AKEETVVENATPDYAAGLVSTQKLGSLNNEPALPSTSYLPATPSVVPSSSYIPSSETQPA
GSAREALQTNRQTEEPAAPNATTTLPAQFKQRTPMYNSNSNPPAATPTSPLTPTTPPAIS
PAAQAPQVAPQTQQQPPPKKSLSLTREQMYAAQEMFKTANKVTRPEKALILGFMAGSREN
PCQEQGDIIQIKLSEHTEDLPKADGTGSTTMLVDTVFEMNYATGEWTRFKKYKPITNVS
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcgagaatcccctcttttttcgccccgctcccaagatggcgtcgatgcgggag
agcgacaccggcctgtggctgcacaacaaactgggctccacggacgagctgtgggcaccg
ccgagcatcgcctcgctgctcacggcctcggtcatcgacaacatccgactctgtttccac
ggcctttcctcggccgtcaagctcaagctgctcctggggatgctgcacctgccccgccgg
gcggtggatgagatgaaaggggcactgactgaaattatccagctcgctaccttggattca
gacccctgggtcttaatggtagctgatattttaaaatcctttccagatactggctccctt
aaccttgatcttgaagaacagaatcccaatgttcaagatattttaggagaacttagagag
aaagtaagtgaatgtgaaacttcagctatgttgccgttggaatgccaatacttaaacaaa
aatgccttgacaacactagctgggccacttactcccccagtgaaacatttccagctgaaa
aggaaacctaaaagtgccactctcagagctgaactcttgcagaagtcaacagaaactgcg
cagcagctcaagaagactgcaggagttcctttccatgccaaaggcaggggcctggtcaag
aagatagatacaacaacaccactcaaaggaataccaaaacaagctccattcaggagtact
tcagctcccagtgtttttagtccttctggaaacagaactcctattcctccttcaagaacg
cctttgcgcaaagaaaggggagtgaagcttctagatatctctgagctggatatggtaggt
gctggccgtgaagcaaagagaagaagaaagacattagatgcagaagttgtggaaaagcaa
gccaaagaagaaacagtagtagaaaatgctaccccagattatgctgctggccttgtatct
acacagaaacttggctcgttgaacaatgagcctgcactaccttctacgagttatttacct
gctacccccagtgtggtgccgtcttcctcctatattccaagctctgaaacacagccagct
ggctctgcacgagaggccttgcagaccaacagacagactgaagagcctgctgctccaaat
gctactacaactcttcctgcacagttcaaacaaagaacacccatgtacaacagcaactct
aatccccctgcagctacacctacctcacccctaacgcccaccacacctcctgccatctcc
cctgcggcacaggcaccacaagtggccccccaaactcagcaacagccaccaccgaagaaa
agcctctctctcacaagggagcaaatgtatgctgcacaggaaatgttcaagactgcaaac
aaagttacaaggccagaaaaggctcttatacttggattcatggcaggatccagagagaat
ccttgccaagagcaaggtgacatcatccaaattaaacttagtgaacatacagaagattta
ccaaaggcagatggcacgggcagcaccactatgttggttgacacagtctttgaaatgaac
tatgctactggtgaatggaccagattcaagaagtacaaacctataactaatgtttcctaa

DBGET integrated database retrieval system