KEGG   Geospiza fortis (medium ground-finch): 102033778Help
Entry
102033778         CDS       T03755                                 

Gene name
PARP3
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 3
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr03410  Base excision repair
gfr04210  Apoptosis
gfr04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    102033778 (PARP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102033778 (PARP3)
   04217 Necroptosis
    102033778 (PARP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gfr03032]
    102033778 (PARP3)
   03036 Chromosome and associated proteins [BR:gfr03036]
    102033778 (PARP3)
   03400 DNA repair and recombination proteins [BR:gfr03400]
    102033778 (PARP3)
Enzymes [BR:gfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     102033778 (PARP3)
DNA replication proteins [BR:gfr03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102033778 (PARP3)
Chromosome and associated proteins [BR:gfr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102033778 (PARP3)
DNA repair and recombination proteins [BR:gfr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     102033778 (PARP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR DUF3337 ZapA
Motif
Other DBs
NCBI-GeneID: 102033778
NCBI-ProteinID: XP_005422488
Position
Un
AA seq 529 aa AA seqDB search
MASKRQASSSKQPDSREKKQKVEEEDDTWSSTLATLKTAPKEKPPATIDGLCPLSSALGA
RVYEDYDCTLNQTNISANNNKFYILQLLEHHGAYSVWSRWGRVGEPGQTKLMPCASLEAA
KRGFEKKFREKTKNSWATRENFIAYPGKYTLIEVQPGAGQEVEATLRGDAVDGDKVCKRR
VLPCTLDRATQDLVSLIFSSDMFRDAMQTMDIDVKKMPLGKLSKQQIARGFEALEELEAA
LREQPPQATRLEEISSRFYTIVPHNFGRARPPTINSPELLRAKKDMLLVLADIELAQSLQ
AQKEKEEEEEKEVAHPLDQDYALLCCQLSLLDPASREYQLIQTYVMQTGHKLHILNIWQV
ARDGEDERFKAHELLEHRRLLWHGTCVAVVAAILRSGLRIMPHSGGRVGRGIYFASENSK
SAGYVGCTSKKVGIMFLTEVALGKPYRITRDDPTLREPPAGYDSVLACGRTEPDPAQDEE
VLLDGKKVLVCQGKPIPMPAYKDSSFSQSEYLIYKESQCRLRYLVQLRF
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaagcgccaggcttcctcctcgaagcagccagacagcagggaaaagaaacag
aaagtggaagaggaggacgacacctggagctccaccttggcaaccctgaaaactgctccc
aaggagaagccacctgccaccattgatgggctgtgccccctgagctcagcactgggtgcc
cgggtctatgaggactatgactgcaccctgaaccagaccaacatcagtgccaacaacaac
aagttctacatcctccagctcctggagcaccatggtgcctacagcgtctggagccgctgg
ggccgcgtgggagagccaggccagaccaagctcatgccctgtgcctccctggaagctgcc
aagaggggctttgagaagaagtttcgagagaagaccaagaacagctgggcaacaagggag
aactttattgcctacccagggaagtacacgctcattgaggtgcagccaggggctgggcag
gaagtggaggctacactcaggggggatgccgtggatggggacaaggtgtgcaagcggcgg
gtgctgccctgcaccttggacagagccacacaggacctggtgtccctcatcttcagcagt
gacatgttccgggacgccatgcagaccatggacatcgatgtgaagaagatgcctctgggg
aagctgagcaagcagcagatcgcgaggggctttgaggcactggaggagctggaggcagct
ctgagggagcagcccccccaggccacccgcctggaggaaatctcctcacgcttctacacc
atcgtcccacacaactttggacgggcacggccccccaccatcaactcccctgagctgctg
cgtgccaagaaggacatgctgctggtgctggctgacattgagcttgcacagagcctgcag
gctcagaaagagaaggaggaagaggaggagaaagaagttgcccatccattggatcaggat
tacgccctgctctgctgccagctctccctgcttgacccagcttcccgggaataccagctg
atccagacctatgtgatgcagactgggcacaaactccacatcctcaacatctggcaggtg
gcccgagatggcgaggatgagcgtttcaaggcccacgagctgctggagcaccggcggctg
ctgtggcacggcacctgcgtggcggtggtggcagccatcctgaggagcgggctgcgcatc
atgccccactccggcggccgcgtgggcaggggcatctactttgcctctgagaacagcaag
tcagccggctatgtgggctgtacatctaagaaagttggcatcatgttcctgacggaggtg
gccctgggcaagccctaccgcatcacgcgcgatgaccccacgctgcgtgagccacccgct
ggctatgacagtgtcctggcctgcggccggacagagccggatcctgcacaggatgaggag
gtgctgctggacggcaagaaggtgctggtgtgccagggcaagcccatccccatgcctgcc
tacaaggactcctccttcagccagagcgagtacctcatctacaaggaaagccagtgccgg
ctccgctaccttgtccagctccgcttctga

DBGET integrated database retrieval system