KEGG   Geospiza fortis (medium ground-finch): 102034126Help
Entry
102034126         CDS       T03755                                 

Gene name
RARS
Definition
(RefSeq) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102034126 (RARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gfr01007]
    102034126 (RARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gfr03016]
    102034126 (RARS)
   03029 Mitochondrial biogenesis [BR:gfr03029]
    102034126 (RARS)
Enzymes [BR:gfr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     102034126 (RARS)
Amino acid related enzymes [BR:gfr01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   102034126 (RARS)
Transfer RNA biogenesis [BR:gfr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102034126 (RARS)
 Prokaryotic Type
   Other AARSs
    102034126 (RARS)
Mitochondrial biogenesis [BR:gfr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    102034126 (RARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e Cnn_1N
Motif
Other DBs
NCBI-GeneID: 102034126
NCBI-ProteinID: XP_005425439
Position
Un
AA seq 664 aa AA seqDB search
MASPVPRNCCVTTQISFQENEIKLLSAEIERLKNFGCLGVSPSLEGLRDENAKLKYRLNF
LKKSLQEERSKSTKSMININSCLQEIFGAAIQAAYPDLENPPLVVTPSQQPKFGDYQCNS
AMGISQILLKTREQKVSPREIAERIVKNIPANECIEKVEIAGPGFINVHLRKDFVSKHLS
SLLINGVQPPAIGKRKKVVVDFSSPNIAKEMHVGHLRSTIIGESMCRLFEFVGYDVLRLN
HLGDWGTQFGMLIAHLQDKFPDYLSVSPPIGDLQAFYKESKQRFDTEEEFKKRAYQCVVL
LQSKNPDFIKAWNLICDVSRREFQKIYNCLDITIIERGESFYHEMMKDIVKEFEDKGFVQ
VDDGRKVVFVPGFPVPLTIMKSDGGYTYDTSDLAALKHRLCEEKGDILIYVVDSGQSVHL
QTVFAAGQMIGWYDPKVTRVTHAAFGVVLGEDKKKFKTRSGDTVRLIDLLEEGLKRAMDK
LKDKERDKVLTPEELKAAQTSVAFGCIKYADLSHNRLNDYVFSFDKMLDDRGNTAAYLLY
AFTRIRAIARLANIDEQMLRKAAREEVLVLDHEKEWKLGKCILRFPEILQKILEDLLLHT
LCDYLYELATTFTEFYDSCYCVEKDRQTGQIVKVNMWRLLLCEATATVMAKGFDILGIKP
VQRM
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccccgttcccaggaattgctgtgtgacaactcaaatttcttttcaggaaaac
gagatcaagttgttaagtgcagaaattgagcgtctgaagaactttgggtgcttgggagtc
tccccgagtttggaagggttgcgagacgaaaacgcaaaactcaagtaccggttaaacttc
ctaaagaagagccttcaagaggaaagaagtaaatcaaccaaaagcatgattaatatcaac
agctgtctccaggagatctttggagctgccattcaggctgcctacccagacttagaaaac
cctcctttagtggtgacaccaagtcagcagcccaaatttggggactaccagtgtaacagt
gccatgggcatatcacagatactgctcaaaaccagggaacagaaggttagcccacgagaa
attgcagagagaatagtaaaaaatattcctgccaatgaatgcattgagaaggtcgaaatt
gctggtcctggttttatcaatgtccacttgagaaaggattttgtgtcgaagcacctgagc
agtttattgatcaatggagttcaaccaccagctattggcaaaaggaaaaaggtggtggtg
gatttttcctcccctaacattgcaaaggagatgcacgttggccacctgcgctccaccatc
atcggggagagcatgtgccgcctcttcgagttcgtgggttatgacgttctcaggttgaac
catttaggagattggggcacccagtttggaatgctcattgctcacctccaggacaaattt
ccagattacttaagtgtttctcctcccattggggatctccaagcattttacaaggaatcc
aagcagaggtttgacacagaggaggagtttaagaagcgagcttaccaatgtgtggtgctg
ctgcagagcaaaaaccccgacttcattaaagcctggaatctcatctgcgacgtgtcacgc
agagaattccagaaaatctacaactgtttggacatcacaatcatagagagaggggaatcc
ttctaccatgagatgatgaaagacattgtgaaagaatttgaagataaagggtttgtccag
gttgatgatggcaggaaggtcgtgttcgtgccgggtttcccagtgccgctgacaatcatg
aaatcagacggaggttacacctatgacacatcagacctggctgctctgaagcacaggctg
tgtgaagagaagggtgacatcctcatctacgttgttgatagtggccagtctgtgcatctc
caaacagtgtttgcagctggacagatgattggctggtatgatcccaaagtcaccagagtg
acccatgctgcctttggagtggtgctgggagaagacaagaagaagttcaagactcgttca
ggggacacggtgcgtcttatagacctgctggaggaaggactgaaacgagccatggacaag
ctgaaagacaaggaacgggacaaggtcctgacgccagaagagctgaaagctgcccagaca
tccgtggcttttggatgcattaaatatgcagatctgtcccacaacaggctcaatgattac
gtgttctcctttgacaagatgctggatgaccgagggaacacagctgcctatctgctctat
gccttcacacgcatcagggccattgctcgcctggccaacatcgatgagcagatgctgcgg
aaggcagccagggaggaggtgcttgtccttgaccatgagaaggagtggaaactgggcaag
tgcatcctgaggtttcctgagatcctgcagaagatcctggaggacttgttattgcacaca
ctctgtgactacctgtatgagctggccaccaccttcaccgagttctacgacagctgctac
tgcgtggagaaggacaggcagactggccagattgtgaaggtgaacatgtggaggctgctg
ctgtgcgaagccactgccaccgtcatggccaagggattcgacatcctgggcattaagcct
gtgcagaggatgtag

DBGET integrated database retrieval system