KEGG   Geospiza fortis (medium ground-finch): 102035277Help
Entry
102035277         CDS       T03755                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00564  Glycerophospholipid metabolism
gfr00565  Ether lipid metabolism
gfr00590  Arachidonic acid metabolism
gfr00591  Linoleic acid metabolism
gfr00592  alpha-Linolenic acid metabolism
gfr01100  Metabolic pathways
gfr04010  MAPK signaling pathway
gfr04217  Necroptosis
gfr04270  Vascular smooth muscle contraction
gfr04370  VEGF signaling pathway
gfr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102035277
   00565 Ether lipid metabolism
    102035277
   00590 Arachidonic acid metabolism
    102035277
   00591 Linoleic acid metabolism
    102035277
   00592 alpha-Linolenic acid metabolism
    102035277
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102035277
   04370 VEGF signaling pathway
    102035277
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102035277
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102035277
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102035277
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102035277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 102035277
NCBI-ProteinID: XP_005419592
Position
Un
AA seq 926 aa AA seqDB search
MSKGFLPMEEPGLYPDNMSKGFLTMEEPGGYPENMSKGFQPLEEPGLYLENMSKGCLPME
EPEVYSANISQELQPMELPEELFYMKGKTMIPSNALGDGNSGLGSLGDGEWQNRKDDGTG
ADQGDFKIESSPCYLLTVRIIRMRNLQRVDALSQADCYVSLWLPTATCERSRTKTVRNSD
NPVWNETFYFRIQSQVKNVLELTVYDEDFATPDDHLLCALFDTAKLPLERTVILYFKPSP
NATEELEVEFKLEVASGPHETIASNGVLVCRELCCLEVEVAEKTKQKSKKELSLTVKGSF
EGTQDIVLGPNGVVSPACPTEFHYIKYAEPTLDVMLPKKRRYHPWSCRYSTETGSPVVML
NSLPMGRKTTIAEEKRFDLNVTAKTCNCSCHQDLDMRFGFNLCSEEMAFLGKRKRYVASA
LKNVFHLPHDLQDQEVPVVAIITTGGGLKSMTGLYGSLMGLKKLNLLDCITYISGLSGTT
WTMANLYRDAYWSQKDLDSHIGEAQKQATKCKMGCFSMDRMKYYNKQLCQRKEEGYRTSF
IDLWGLMIEYLLNDGKDPHKLSDQQEALCDGQNPLPIYVSVCVRDSYSTNDFKEWVEFTP
YEVGLLKYGAFVRTEHFGSEFFMGRMLKKVPESRICYLQGMWSSIFSVNLLQIWGLSHSS
EDFWKRWTEDRIDEVDEDPVLPTRPHELRTRMYTPPGPLSSALRGALTDRFSVAQHHNFL
KGYQLHNNYMENEHFCRWKDTVLDSRPNQLMQSPDQLGMIDAGFFINTSSAPLLRPQREV
DVIIYLSYTTGSHTSSLDKACKYYSEQKIPFPTISLTDEDKKNLKECYIFQDSDLPGCPI
VIFLPLVNDTFQEYKAPGVKRCCSEMEEGQLDLTSSCSPYCMFSVRYTDENYRKLLNLSE
YNILNNSQMIMQALQTAMQRRRQKMC
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggatttctgcccatggaggagccaggactgtatcctgacaacatgtctaaa
ggattcttgaccatggaggagccaggaggatatcctgaaaacatgtctaaaggcttccag
cccctggaggagccaggactatatcttgaaaacatgtctaaaggatgtctgcccatggag
gagccagaagtatattctgcaaatatatctcaagaattgcagcccatggagttgccagaa
gagctcttctacatgaaagggaagaccatgataccatcaaatgcactaggggatggaaac
tcaggcctcggttccttgggagatggtgaatggcaaaacaggaaagatgacggtactggg
gcggaccaaggtgatttcaagatagaatcctctccttgctacctgttgaccgtaaggatc
atccggatgagaaatctccagcgagtggatgccttaagccaggctgattgctacgtgtcc
ttgtggctgccgactgcgacgtgtgaaaggtcacgcactaaaaccgtgagaaactctgac
aatccagtgtggaacgaaaccttctacttcagaatccagagtcaggtcaagaatgtgctg
gagctcacggtgtatgatgaggattttgctactccagatgaccatctcctctgtgcactc
tttgatactgctaaacttccacttgaaagaacagtgatcctatacttcaaacctagtcca
aatgccacggaggaactagaggttgaattcaaattggaggttgcatctggtcctcatgaa
acgattgctagcaatggagtgctggtgtgtcgtgaactttgctgcttggaagttgaagtg
gcagagaagacgaagcaaaaatcaaagaaagagctttccctgactgtgaagggctccttt
gaggggacgcaggatattgtgctgggccccaatggagtggtcagcccagcgtgtcccact
gagttccactacatcaagtacgcggagccaacgctggatgtcatgctgccaaagaagagg
cgctaccacccttggtcctgtaggtacagcacagagacgggctcccctgtcgtgatgctg
aactcgctgcccatgggaaggaaaacaaccattgcagaggagaaaagatttgacttgaat
gtgacagcaaagacttgcaattgttcatgccaccaagacctggacatgcgctttgggttt
aacttatgttctgaagagatggctttcctggggaaaagaaagagatatgtagcaagtgct
ctcaaaaatgtttttcacctaccacacgatctgcaggatcaagaagtccctgtcgtggct
atcatcacgacaggaggaggactgaagtcaatgacagggttgtatggcagcctcatggga
ctcaagaagttaaatctcctggactgtataacatacatcagcgggctgtccggcaccacg
tggaccatggccaacttatacagagatgcctactggtcacagaaggacctggactcacat
attggtgaagcccaaaaacaagcaacaaaatgcaagatgggctgtttctctatggatcgc
atgaagtactacaacaagcagctttgccagaggaaagaagagggatacaggacatcattt
atagatctttggggtctcatgattgagtacttactaaatgatgggaaagacccccacaag
ctctcagatcagcaagaagcactgtgtgatggccagaacccactgcccatctatgtgtcg
gtctgcgtccgggacagttacagcaccaatgatttcaaagagtgggtggagttcactccc
tacgaggtgggactgctgaagtacggcgcgtttgttcgcacggagcattttggaagtgag
ttcttcatgggccgcatgttaaaaaaggtcccagagtcccgcatctgctaccttcaaggt
atgtggagcagtatattttctgtgaaccttttacaaatatggggactgtcccacagttca
gaggacttctggaagagatggacagaagacagaatagatgaagtcgatgaagacccagtg
ctgcccacaagaccccacgagctgaggactcgcatgtacaccccgcctggccccctgtcc
agcgccctccggggcgcgctgaccgaccgcttctccgtggcccagcaccacaacttcctg
aagggctaccagctgcacaacaactacatggagaacgagcacttctgtcggtggaaagac
actgtgttagactcacgtcccaaccagctgatgcaaagtcctgatcagctgggcatgata
gatgctggatttttcatcaataccagcagtgcaccacttttaaggccacagagggaggtg
gatgtcatcatctatctaagttacactactggatcacatacatcgtctctagataaggca
tgtaaatactactcagagcagaaaatcccattcccaacaatttctttgactgatgaagat
aagaaaaatctgaaggagtgctacatcttccaagattcagatttgccaggatgtccgatt
gtgatttttcttccccttgtgaatgacaccttccaagagtacaaagcacctggtgtcaag
cgctgttgctcagagatggaggaaggccagctggatttgaccagctcctgttccccctac
tgcatgttctcggtcagatacaccgatgagaactaccgcaagctgctcaatctcagcgag
tacaacatcctcaacaactctcagatgattatgcaggccttgcagacagcgatgcaaagg
agaaggcagaagatgtgctga

DBGET integrated database retrieval system