KEGG   Geospiza fortis (medium ground-finch): 102036244
Entry
102036244         CDS       T03755                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
gfr  Geospiza fortis (medium ground-finch)
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gfr03021]
    102036244 (AFF3)
Transcription machinery [BR:gfr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102036244 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 102036244
NCBI-ProteinID: XP_014162090
Position
Un
AA seq 1097 aa
MGSKPKELEAIVPQENCNNMVTVTEVWRGDFHRWSAAVDGCEHLRRDSVYEPDRNVLRRK
EWERRNQEAQQDNGTFNTSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDLLTDRSNQS
HLVGVPKPGVPQTSLPKTDEHLIADSRPPPPPPPPISSTTSSTPASLAAQQSKSATMGWQ
KAGHNATSDGQQRASKHGHRSLESHKGDFKLASQKSNLEKLKRYASSPTSSSSSSSSSSS
SSSSSSSSSNTAQQSSLRATLGDNTNRVQQAAKLSCSSEGGTKVQERPAKHGGGHCVQNF
PPSLASKPSLGQQKPTAYVRPMDGQDQAPDESPKLKLPAETTKSYRGVPSSKPDSARTKS
KITKFSIPKQEEDSGTGDNSCIEEILREMTHSWPPPLSAIHTPGKAEQSKFPFPNKESQQ
GSTGHSNTRKSDVEPKTPEKSATHTSMLEDDLKLSSDEEENDQQAAQRSALRVLSDSSLV
VPQANARASGLSSKGWSSSSSSESESSSESDSESESSSSESDGSKASHYSSPEPEPPSSN
KWQLDKWLNKVTPHKAPILTHPDGPALEAHPYYGRVKAERQEGQKTPAEGSAEHRTFGSI
NARTSSEIAKELEEQFYTLVPFGRNELLSPLKDSDEVKSLWVNIDLALLSRIPERLPEEP
LAMSAGANQAASFPQGSSAEPPAEKGLPKSRRKRKCENEEECRDIKKTHLERESSSRLAA
SAQSITTANHCNMNENSLAIPINKNEKMLRSPVSPLSDASKHKYSNDDLTSSSRPNGSSL
LPSISSSKKHKGEIQSQPHPGDFNKAIHINSENVLLCNKPQFQTEPWSPLSTTPRDCRRT
KLIFDDIPRNADYFMQEAKRKKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESK
SPYTMYSETVELIRYAVRLKTHSGPSATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKY
SKALIEYFKNSSKAAQNPSPWSASGKSTGTPSPMSPSPSPVSSVGSQGSTGAPSPSPIIS
IPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENRDFFNDLDALMGPITLHSSMEHLV
QYTQQGLHWVRNSAHLS
NT seq 3294 nt   +upstreamnt  +downstreamnt
atggggagcaaacccaaggagctggaagccatcgtgcctcaggaaaactgcaacaacatg
gtcactgtcacagaggtgtggcggggtgactttcaccgctggagtgctgcagtggatggc
tgcgagcacctcagaagggacagtgtctatgagccagacagaaatgtgctgcgaaggaag
gagtgggaaaggagaaaccaggaggcccagcaggacaatggcacgtttaacacgagctat
tctctcttcagtgaaccctacaagactaacaagggggatgagctttccaatcgcatccag
aatactttgggcaactatgatgaaatgaaagacttgttaactgaccggtcaaaccagagc
catctcgttggggttccaaaacctggggttcctcagacatctctccccaagactgatgaa
catcttatcgcagactcgagaccaccacctcctcctcctcctccaatttccagcactact
tcttccacaccagcatccctagctgcccagcagagcaagagcgccacaatgggctggcag
aaggctgggcataatgccacttcagatggccagcagagagcgagcaaacacggacaccgg
tcgctggagtcacacaagggtgacttcaaactggccagccaaaaatccaatttggagaaa
ctaaaacgctatgcatcgagtcccacctcctcctcttcctcctcctcttcctcttcctcc
tcctcctcctcttcctcctcttcctccaatactgcccagcaaagctcgctgagggccaca
ttaggagacaacaccaacagagtccagcaggcagcgaagctcagttgtagctcagaagga
ggaaccaaagtccaagagaggccagcaaagcatggtggggggcactgtgtccaaaacttc
ccaccttctcttgcttcaaagcccagtctgggtcagcagaagccaacagcctatgtaagg
ccaatggacggtcaggaccaggctccagatgagtctccaaagctgaagttaccagcagag
acaaccaagtcatatcggggagtgccttccagcaagcctgattcagccaggaccaagtca
aagatcaccaagttcagcattcctaagcaagaagaagacagtggaacaggagataacagc
tgcattgaagaaatattgcgggagatgacccattcatggcctccgccactgtcagcaatt
cacacaccaggaaaggcagaacaaagcaagtttcccttcccaaacaaggagtcacaacag
ggatctacaggacacagcaatacaaggaaaagtgatgtagagccaaagaccccagagaaa
agcgcaacccatacatcgatgctagaagatgacctcaagttaagcagtgatgaagaggag
aatgaccagcaggcagcacagagatctgctctccgcgttctatctgacagcagcctggtg
gtgccgcaggccaatgcccgagcctcgggactctccagcaagggctggagcagcagcagc
tccagtgaatccgagagcagctccgagtctgactcagagagcgaaagcagctccagcgag
agtgacggcagcaaggcctcgcactactccagcccagagcccgagccaccctcgtccaac
aagtggcagctggacaagtggctgaacaaagttacccctcacaaagcacccatcctcacc
caccccgatggcccggcgctggaagcccacccctactacggccgcgtgaaggcagagcgg
caggaaggacagaagaccccggctgagggctcggccgagcatcgcacctttggctctatt
aatgccaggactagtagtgaaatagcaaaggagctggaggaacagttttacaccctggtt
cctttcggtaggaatgagctcctgtctcctctgaaagacagtgatgaggtaaaatcgctg
tgggtcaacattgacttggctcttttgtccaggattccagagcgtttgcccgaagaaccg
ctggccatgagcgccggagcaaaccaggcggccagcttcccgcagggtagtagtgctgaa
ccccccgcagagaagggtttaccgaaatctagaaggaaacgcaagtgtgagaatgaggaa
gagtgcagagatatcaagaagacccacttagagcgagagagttcttcacgattagctgcc
tctgcccaaagcatcacaacagcaaatcactgcaatatgaatgaaaatagcttggcaata
ccaataaataaaaatgagaaaatgcttcggtcacccgtctctcccctctctgatgcatca
aaacacaaatattccaacgatgatttaacttcctccagcagacctaatggcagcagtcta
ttaccttcaatctcctccagcaaaaaacataagggtgaaatccagtcacagccacatcct
ggggacttcaataaagcaattcacatcaattcagaaaatgttcttctctgcaataagcca
cagttccaaacagagccttggtcacctctgtccaccacacccagggactgcagaagaaca
aagcttatctttgatgatataccacgcaatgcagattactttatgcaggaagctaaacgg
aagaagcataaagcagatgcaatggtggagaagtttggaaaggcactgaattatgcagaa
gcagcactatcgtttattgagtgtggaaatgcaatggaacaaggcccaatggaatctaaa
tccccttataccatgtattcagagacagttgaactcatcaggtatgcagtgagactaaaa
acccactcaggccccagcgccacgccagaagacaaacagctggcagcattatgttaccgc
tgcctggcccttctgtactggaggatgttccggctcaagagagaccacgcggtcaagtat
tcaaaagcgcttattgagtatttcaagaattcatcaaaagctgcccagaacccatctcct
tggagtgccagtggaaagagcacaggaactccatcacccatgtcccctagcccttctcca
gtcagttctgtaggatcccaggggagcacgggggccccttccccatctcctatcatcagc
atcccgcagcgcattcatcagatggctgccaaccacgtcagcatcaccaacagcatcctg
cacagctatgactactgggagatggctgacaacctggccaaggaaaacagagattttttt
aacgacttggatgcattgatgggacctatcaccttgcacagcagtatggagcatttagtc
cagtacactcaacaaggacttcactgggtgcggaatagtgctcacttgtcataa

DBGET integrated database retrieval system