KEGG   Geospiza fortis (medium ground-finch): 102036854Help
Entry
102036854         CDS       T03755                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04012  ErbB signaling pathway
gfr04020  Calcium signaling pathway
gfr04114  Oocyte meiosis
gfr04217  Necroptosis
gfr04261  Adrenergic signaling in cardiomyocytes
gfr04310  Wnt signaling pathway
gfr04912  GnRH signaling pathway
gfr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102036854 (CAMK2G)
   04310 Wnt signaling pathway
    102036854 (CAMK2G)
   04020 Calcium signaling pathway
    102036854 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102036854 (CAMK2G)
   04217 Necroptosis
    102036854 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102036854 (CAMK2G)
   04916 Melanogenesis
    102036854 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102036854 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102036854 (CAMK2G)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102036854 (CAMK2G)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   102036854 (CAMK2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Kdo SnoaL_2 RIO1
Motif
Other DBs
NCBI-GeneID: 102036854
NCBI-ProteinID: XP_014164677
Position
Un
AA seq 535 aa AA seqDB search
MAGAFSVVRRCVKKNSSQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSI
SEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPE
NLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWAC
GVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKR
ITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSAAKSL
LNKKSDGVKPQSNNKTSIVSTAKETPPVQTSMEPQTTVVHNATDGIKGSTESCNTTTEDE
DLKAPPLSTGDGSSVLEGRRHSESKTQTESMQSQLSLCFSAMRKQEIIKITEQLIEAINN
GDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIG
EDAACIAYIRLTQYIDGQGRPRTTQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagccttctctgtggtccgcagatgtgtaaagaaaaattcttcacaggaatat
gctgcaaaaatcatcaacaccaaaaaactgtcagccagagatcaccagaaactggaacgt
gaagctcgaatttgccggcttctaaagcatccaaatattgtgcgactccatgacagtatt
tcagaagaaggtttccattacctcgtctttgatctggttactggtggagagctctttgaa
gatattgttgctagagaatactacagtgaagcagatgccagccactgtattcatcagata
ctggagagtgtgaatcacattcaccagcatgatattgtgcacagggacttgaagcctgag
aatttactactagcgagtaaatgtaagggtgctgctgtcaaactggctgacttcggactg
gctatagaagtccagggagagcagcaggcctggtttgggtttgctggtactccaggctac
ctctcccctgaagtcttaagaaaagatccttatggaaaaccagtggatatatgggcatgt
ggagtgattctgtacatattactagtggggtaccctcccttttgggatgaagatcagcac
aaactctatcagcagatcaaggccggagcctatgacttcccatcacctgagtgggacact
gtgactcctgaagccaagaatttgattaaccagatgctgacgataaacccagcgaagcgc
atcacagctgaccaggctctcaaacacccatgggtttgtcaacgatccactgtcgcatca
atgatgcacaggcaggagactgtggaatgcttgagaaagttcaatgctagaaggaagcta
aagggtgcaatcctcacgacgatgcttgtgtctcggaatttttcagctgccaaaagcttg
ctgaacaagaagtcagatggagtgaagccacagagcaacaacaaaaccagtatagtaagc
actgcaaaagaaacacccccagtgcagacgtccatggagcctcaaacaactgttgtccat
aatgctacagatggcataaagggttccacagagagctgtaacaccacaactgaagatgag
gatctgaaagctccccctctctccaccggggacggcagctcagtgcttgaaggacggagg
cacagtgagagcaaaacacagactgagtccatgcagtcccagctttctctctgtttctca
gccatgcgtaagcaagagatcattaagataacagagcagctgatagaggccatcaacaat
ggagattttgaggcttatacaaaaatctgtgatcctggcttgacctcatttgaacctgaa
gcactggggaacctggttgaaggaatggatttccataagttttactttgaaaacttactg
tcgaagaacagcaagccaatccacacgaccatcctgaacccccacgtgcacgtcatcggg
gaggacgccgcctgcatcgcctacatccgcctgacgcagtacatcgacgggcagggccgg
ccccgcaccacacagtccgaggagacgcgcgtctggcaccgccgcgacggcaagtggctc
aatgtgcactaccactgctctggagctcctgcagcacctctccagtga

DBGET integrated database retrieval system