KEGG   Geospiza fortis (medium ground-finch): 102037698Help
Entry
102037698         CDS       T03755                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04060  Cytokine-cytokine receptor interaction
gfr04068  FoxO signaling pathway
gfr04110  Cell cycle
gfr04218  Cellular senescence
gfr04350  TGF-beta signaling pathway
gfr04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102037698 (TGFB2)
   04350 TGF-beta signaling pathway
    102037698 (TGFB2)
   04068 FoxO signaling pathway
    102037698 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102037698 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102037698 (TGFB2)
   04218 Cellular senescence
    102037698 (TGFB2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102037698 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gfr04052]
    102037698 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:gfr00536]
    102037698 (TGFB2)
Cytokines and growth factors [BR:gfr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102037698 (TGFB2)
Glycosaminoglycan binding proteins [BR:gfr00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102037698 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 102037698
NCBI-ProteinID: XP_005416205
Position
Un
AA seq 412 aa AA seqDB search
MHCYLLSVLLTVDLATVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPDEYPEP
EEVPPEVISIYNSTRDLLQEKANHRAATCERERSDEEYYAKEVYKIDMQPFYPENTIPPS
YYSLYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNTKARVSEQRIELYQVLKSKELSSPG
QRYIDSKVVKTRAEGEWLSFDVTEAVHEWLHHRDRNLGFKISLHCPCCTFVPSNNYIIPN
KSEELEARFAGIDDYTYSSGDVKALKSNRKKYSGKTPHLLLMLLPSYRLESQQPSRRKKR
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYHANFCAGACPYLWSSDTQHSR
VLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcactgctatctcctgagcgtgctcctcaccgtggatctggccaccgtggctctcagc
ctgtctacctgcagcaccctcgacatggatcagtttatgcgcaagaggatcgaggcaatc
cgggggcagatcttgagcaaactgaagctcaccagccccccggacgagtaccccgagccc
gaggaggtgcccccggaggtcatctccatctacaacagcaccagggacctgctgcaggaa
aaagccaaccacagagccgccacttgcgagagggagaggagcgacgaggagtattatgcc
aaagaagtttacaaaatagacatgcagcctttttaccccgaaaacaccatcccgccgagc
tattacagcctatatttccgaatcgtccggtttgacgtgtcggccatggagaagaacgcc
tccaacctggtgaaggccgagttcagggtcttccgcctgcagaacaccaaggcgcgcgtg
tcggagcagcggatagagctgtaccaggttttaaaatctaaagaattatcatccccagga
cagcgctatattgacagcaaagtagttaaaacaagagctgaaggagaatggttgtctttt
gatgtcactgaggctgtacatgaatggctccatcacagagacagaaatcttggatttaag
ataagtttacattgtccatgctgtaccttcgtgccttccaataattacatcatcccaaat
aaaagtgaggagcttgaagcaagatttgcaggtattgatgactacacatattccagtggt
gatgtgaaagctttaaagtccaataggaaaaaatacagtgggaagaccccacatcttctg
ctaatgttgttaccctcctacagacttgagtcgcaacagcccagtcggcggaagaagcgt
gctctagatgctgcctattgttttaggaatgtgcaggataattgctgtctgcgtccactt
tatattgacttcaagagggatcttggctggaaatggattcatgaacctaaaggataccat
gctaatttctgtgcaggagcctgcccatatttatggagctcagatactcagcacagcaga
gtgctcagcttgtataacaccataaatccagaagcttcagcctccccatgctgtgtgtcc
caggatttggaacccctcaccatcctctactacattggaaaaacacccaaaatcgaacag
ctttccaacatgattgtcaagtcttgcaagtgcagctaa

DBGET integrated database retrieval system