KEGG   Geospiza fortis (medium ground-finch): 102038779
Entry
102038779         CDS       T03755                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00230  Purine metabolism
gfr00240  Pyrimidine metabolism
gfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102038779
   00240 Pyrimidine metabolism
    102038779
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102038779
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28 AAA_17
Other DBs
NCBI-GeneID: 102038779
NCBI-ProteinID: XP_005418920
Position
Un
AA seq 244 aa
MGKEETTAAGKSTFVRLLEKHSDEWEIIPEPIAKWCNIQTAEDEYKELSTSQKSGGNLLQ
MLYDKPSRWAYTFQTYACLSRVKAQLKPLSAKLYEAEHPVQFFERSVYSDRYVFASNLFE
SGSINETEWSIYQDWHTWLLNQFQSDVELDGMIYLRTTPQKCMERLQTRGRKEEQGIELE
YLENLHYKHETWLHERTMRVDFENIKEIPILVLDVNEDFKNDKIKQEYLVDKVKSFLTSL
EDEN
NT seq 735 nt   +upstreamnt  +downstreamnt
atggggaaagaagagacaacggctgcggggaagtcaacgtttgtcaggctgctggagaaa
cacagcgatgagtgggagatcatccccgagcccatcgctaagtggtgcaacatccagaca
gccgaggatgagtataaggaactttcaacatctcagaagagcggaggaaacttacttcaa
atgctgtatgacaaaccctcaagatgggcttacacatttcagacttatgcctgcttgagc
cgagtaaaagcacaattaaaacctctctcagccaagctgtacgaagcagaacatccagtg
caattttttgaaagatctgtgtacagtgacagatacgtgtttgcttctaacctgttcgag
tctggaagtattaatgaaacagagtggtctatttatcaggactggcacacatggcttttg
aatcagtttcaatcagatgtagaactggatggcatgatctatctcagaaccacacctcag
aaatgcatggaaaggctacagacgaggggaagaaaagaggagcaaggaattgagcttgag
tatttggaaaacctccactataaacatgaaacctggcttcatgaaaggactatgagagtt
gattttgagaacattaaggagattcctattctagttttggatgttaatgaagattttaag
aacgataagattaaacaagagtacctggttgataaagtcaagtcattcctgacttcttta
gaagacgaaaattaa

DBGET integrated database retrieval system