KEGG   Geospiza fortis (medium ground-finch): 102039972
Entry
102039972         CDS       T03755                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
gfr  Geospiza fortis (medium ground-finch)
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gfr01009]
    102039972 (AKAP5)
Protein phosphatases and associated proteins [BR:gfr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102039972 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 102039972
NCBI-ProteinID: XP_014167295
Position
Un
AA seq 500 aa
MVKAAKEIEMENPREAETPSTGATCSPPEEQAKKPSMLCFKKRKKSCKKGLTVKDACEGA
SEEKSQRVSADQEEAKASIPSRSSKGTWAAIKNLARPQRRQKSSSRKKVPSDSQVQLEVD
AEESCAQDLPKKRASSGVKMPCVRFSRGKKKPSPSEAVEESEGSAQANEVMGVVNKASEE
PEDLAPTDKSESLSPVSAQEEQDRVKQEQHRMKEDQDTRKKDQDTMKEDQDTVKEDNHTA
KESDTSVGKSEPLTEPTRDAEQSECTVQLEITSSETFDETAQDKLQEGSLPPSTDDVEGR
AVAPEVPVSKDQPDNAPEITECQEIPHICKEMPERDELEKSINLSKECKTEETVTDFSEL
ASRGDDATSVQETASAQDILEANAGAGVSIVITITEAEDSDNTDSDQAYEPSPVLHQKKQ
KGNKKSNRNADVGQKEGPEAGGGPQAEEKGLGDQGHRTGEQYELLLIETASSLVKAAIQS
SIEQLVNEMALEQNKHNSFL
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggtgaaggcagccaaggaaattgaaatggagaacccaagagaggcagagactcccagc
acaggggccacatgttccccaccagaggaacaagcaaaaaaaccctccatgctctgtttt
aagaagcgtaagaagtcctgtaagaaggggctaactgtgaaggatgcgtgtgaaggagcc
tcagaggagaaaagccaacgtgtcagcgctgaccaagaggaggccaaggcttccattcca
tcacgatcctccaaaggaacctgggcagccatcaaaaacctcgccaggcctcagagaagg
cagaagtcctcctcacggaagaaggtgccctctgattcccaagtgcagctggaggtggat
gctgaggagagctgtgcacaggacctcccaaagaaacgggcgagctctggggtgaagatg
ccctgtgtgaggttctccagaggtaagaaaaaacccagcccctcagaagcagtggaggaa
tcagagggcagtgctcaagcaaatgaagtgatgggtgttgtgaataaggctagtgaagag
ccagaggatttggccccgacggacaaatctgaatccctcagcccagtctctgcacaggag
gagcaggatagggtgaagcaggagcagcatagaatgaaggaggaccaggatacaaggaag
aaggaccaggatacaatgaaagaggaccaggatacggtgaaagaggacaaccatacagca
aaggaaagtgacacctctgttgggaagagtgagcccttgacagagcccacacgggatgca
gaacagtcggagtgcactgttcaactggagataaccagttcagagacatttgatgaaaca
gcccaggacaaactgcaggaagggagtctgcccccaagcactgatgatgtggagggcagg
gcagttgctcccgaagtgcctgtttctaaagatcaacctgacaatgcccctgaaatcaca
gagtgccaggaaatccctcatatctgtaaagagatgcctgaaagggatgaattggaaaag
agcataaatctttctaaggagtgcaaaactgaggagactgtaactgattttagtgagttg
gcatccagaggtgatgatgccacaagtgtacaggagacagcgagtgcccaggatatacta
gaagcaaatgcaggcgctggtgtcagcatcgtaatcaccatcactgaagctgaggactct
gacaacaccgactctgaccaggcctatgagccatcccctgttttgcaccaaaaaaagcaa
aaagggaataaaaaatcaaacaggaacgctgatgttggtcaaaaagagggccctgaggct
ggtggcggtccccaggcagaggagaaaggtctgggtgaccaggggcacagaactggggag
cagtacgagctgctcctcatagaaaccgcctcctccctcgtgaaggcggccattcagtca
tccatagagcagctggtcaacgaaatggccctggaacagaataagcacaacagctttctg
tga

DBGET integrated database retrieval system