KEGG   Geospiza fortis (medium ground-finch): 102040095Help
Entry
102040095         CDS       T03755                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 12-like
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
gfr  Geospiza fortis (medium ground-finch)
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102040095
Enzymes [BR:gfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     102040095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE zf-CCCH_4 zf-CCCH zf_CCCH_4 zf-CCCH_8
Motif
Other DBs
NCBI-GeneID: 102040095
NCBI-ProteinID: XP_014162498
Position
Un
AA seq 619 aa AA seqDB search
MRDHDRAFNLDIETKGVREQPSGCMVRKVAQGQCGQLHICKYHLKGFCRNQLARKGCRFV
HSFHSDHNLRVLKQYGLENLNHDELCQLLLQNDPSLLPEVCLHYNKGDGLHGSCSFKTSC
TKLHVCQYFLRGQCRFGSSCKRSHDLLNPECFEKLERQGMSSDIIKKLPSTYRNMYDIKN
GNRSMYDIEDAKSSPCKDGKPSTRRDSSTSKEDESEQICLHHLYRSCGFKEKCIRTHFHL
PYRWQYSEGNTWKDFTNMEEIEDAYCDPKNVRFDCAFTEEFLFPFSICFRDMCCGLKKVR
RLSTASSVTKPPHFILTTEWIWYWKDEYGTWQEYGKQDDLHAAATVSSDDLEKAYLTESS
PKMTFKAGRHEYEINFVSMMQKNLRYKTERKICRRPKFVSQSEVEKTKARGVKHTEGFKN
IPPHWDKSALPELGFKLIELDCSSEEYKKVKVDFQRTMPKAAIKKICRVQNPSLWELYQW
QKDLMQKSNGGKAADERFLFHGTSKKDIDAICQQNFDWRICGLHGTVYGKGSYFARDASY
SDNYCGADSNTKTMFLARVLVGEFTLGSSHYVRPPMKDNQKFYDSCVNNSSNPSIFVIFE
KQQIYPEYLIEYQASARLL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaccatgaccgagcttttaatttagatattgaaacgaaaggagtgcgagagcag
ccttcaggatgtatggtcagaaaagtggcacaggggcagtgcgggcagctgcacatctgc
aagtaccacctgaagggcttctgccgcaaccagctggccaggaagggatgcaggtttgtt
cacagcttccactcagaccacaatctccgtgttctaaagcaatatggacttgagaattta
aaccatgatgaactttgccagcttctgcttcaaaatgacccttccctcttaccagaggtc
tgcttgcattataacaaaggtgatggacttcatggatcttgttcctttaaaacatcctgc
accaaacttcatgtttgccagtactttttgcggggtcagtgcagatttggcagcagctgc
aaacgatcccatgacttattaaatccagaatgttttgagaaactggagagacaggggatg
agctcagacattattaagaaactaccttccacttatagaaacatgtatgacataaaaaat
ggcaacagaagcatgtatgacatagaggatgccaaatcttcaccatgcaaagatggaaaa
cccagcactagacgggattcctcaacttcaaaggaggatgaatcagaacagatatgttta
catcatctgtacagaagttgtggctttaaagaaaagtgtatcagaacccattttcacttg
ccatatagatggcagtactctgagggtaatacctggaaggacttcacgaatatggaagaa
atagaagacgcatattgtgacccaaaaaacgtcagatttgattgtgcttttactgaagag
ttccttttcccgttcagtatttgttttcgtgacatgtgctgtgggttgaaaaaagtcaga
cgtctttctacagcctcctctgtgaccaaacctcctcacttcatccttacaacagaatgg
atctggtactggaaagatgaatatggcacgtggcaggagtatggaaaacaagatgatctt
catgcagctgctactgtctccagtgatgacctggagaaagcttatttgactgaaagttct
ccaaagatgaccttcaaagctggaagacatgaatatgaaataaattttgtgtccatgatg
cagaaaaaccttcgctacaaaacagagaggaagatttgcagaagacctaaatttgtctct
cagtcagaggtggaaaagacaaaagccaggggcgttaaacatacagaaggatttaagaac
attccacctcactgggacaaatctgccctgcctgaactgggattcaagctgattgagctt
gactgttcttctgaagaatacaagaaagtcaaagtggactttcagcgcacaatgcccaaa
gcagctattaaaaagatttgtagagttcagaacccatccctctgggaactgtatcaatgg
cagaaggacctaatgcagaagagcaatggtggaaaggctgcagatgagcgatttttattt
catgggaccagtaaaaaagacattgatgccatctgccagcaaaactttgactggagaatc
tgtggcctccatgggacagtctacggcaaaggcagctattttgcaagggatgcttcttat
tctgacaactactgtggggcagactcaaacaccaagaccatgttcctggcacgagtgctg
gtgggggagttcactcttggtagttctcattatgttcggcctcccatgaaggacaaccaa
aaattctatgacagttgtgtgaataactcctcaaacccttctatctttgtcatctttgag
aagcagcagatttatccagagtatctcatagaataccaggcatcagcaagacttctatag

DBGET integrated database retrieval system