KEGG   Geospiza fortis (medium ground-finch): 102040232Help
Entry
102040232         CDS       T03755                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-3-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00232  Caffeine metabolism
gfr00983  Drug metabolism - other enzymes
gfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    102040232
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102040232
Enzymes [BR:gfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     102040232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 102040232
NCBI-ProteinID: XP_005428819
Position
Un
AA seq 287 aa AA seqDB search
MDIKEYFARISYQGSHNKPDLATMSDIFQHHIRAIPYENLSIHYGERIELDLEPIYNKIV
RKKRGGWCMENNYLLSWVLKTLGYEITLLGAKVYVPERDAYPEDINHLLLRVDLDGKSYI
VDGGFGMAYQLWQPMELISGTDQPQTPGVFRFQEENGTWYLEKVKRKQWVLNPSTSTSPN
VENEVCRRVYLFTLQPRDIEEFRGCNAHLQTAPNSKFVLKSMCSLQTADGIRELVGWKLT
EIKYNYRDNMDLVEIRILAEEELEKTLKEKFSLTLDKKFVPVDNKLF
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggacatcaaggagtattttgccagaatttcttaccagggctcccacaataagccagac
ctggctaccatgtcagatatattccagcaccacatccgtgctatcccctatgaaaacctc
agcatccactatggagaaagaattgagctggacctggaaccaatctacaacaagatagtg
aggaagaaacgtgggggctggtgcatggaaaacaactaccttctgtcttgggtcctgaaa
actcttggctatgaaatcacccttctgggagcaaaagtttatgtcccagagcgtgatgcc
tacccagaggatatcaatcatctgctgctacgagtggatcttgatggcaaatcctacatt
gtggatgggggatttgggatggcctaccagctgtggcagccaatggagctgatttcaggg
acagatcagcctcagactcctggggtctttcgttttcaggaggagaatgggacatggtac
ctggagaaagtgaaaaggaagcagtgggttctgaacccaagcacttcgacttccccaaat
gtggaaaatgaagtttgccgtcgggtttatctctttacccttcagccacgagacattgag
gagttcaggggctgcaatgcccacctgcagacagcacccaactcaaagtttgtattgaaa
tccatgtgcagtctgcagactgctgacggcatccgggaactggtggggtggaaactcaca
gagataaagtacaattatagagacaatatggatcttgtggaaatcagaatccttgcagag
gaagaattagagaaaacactgaaggaaaaattcagtctaacactagacaagaaatttgta
cctgttgataacaagttgttctaa

DBGET integrated database retrieval system